Project name: query_structure

Status: done

Started: 2026-03-16 22:49:11
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVSGSKSTATISGLKPGVDYTITVYAKYLFWKGYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-2.5945
Maximal score value
2.9929
Average score
-0.2061
Total score value
-18.9582

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7703
2 S A 0.7445
3 S A 0.6402
4 V A 0.4675
5 P A 0.0000
6 T A -1.5536
7 K A -2.5945
8 L A 0.0000
9 E A -1.8879
10 V A 0.1033
11 V A 1.5327
12 A A 0.8892
13 A A 0.2909
14 T A -0.3463
15 P A -1.1084
16 T A -0.9906
17 S A -0.5316
18 L A 0.0000
19 L A 0.7278
20 V A 0.0000
21 S A -0.8840
22 W A 0.0000
23 D A -2.3881
24 A A -1.0956
25 P A 0.0638
26 A A 0.4829
27 V A 0.9967
28 T A 1.0242
29 V A 1.3293
30 V A 1.8551
31 F A 1.5688
32 Y A 0.0000
33 D A -0.0164
34 I A 0.0000
35 T A -0.4604
36 Y A -0.2851
37 G A 0.0000
38 E A -1.5498
39 T A -1.2507
40 G A -1.2460
41 G A -1.4339
42 N A -1.5615
43 S A -0.8857
44 P A -0.3280
45 V A 0.4409
46 Q A -0.8202
47 E A -1.5785
48 F A -0.5390
49 T A 0.0872
50 V A 0.3181
51 S A 0.0734
52 G A 0.2315
53 S A -0.5245
54 K A -1.3749
55 S A -1.0323
56 T A -0.5941
57 A A 0.0000
58 T A 0.2586
59 I A 0.0000
60 S A -0.6595
61 G A -1.0262
62 L A 0.0000
63 K A -2.3525
64 P A -1.6362
65 G A -1.4298
66 V A -1.3798
67 D A -2.0840
68 Y A 0.0000
69 T A -0.7713
70 I A 0.0000
71 T A -0.0928
72 V A 0.0000
73 Y A 0.6296
74 A A 0.0000
75 K A 1.1130
76 Y A 2.2819
77 L A 2.9929
78 F A 2.9750
79 W A 1.8017
80 K A -0.3813
81 G A 0.2855
82 Y A 0.9946
83 S A 0.6248
84 S A 0.1131
85 P A 0.2797
86 I A 0.1262
87 S A -0.4965
88 I A -0.7109
89 N A -1.7244
90 Y A -1.4638
91 R A -2.5104
92 T A -1.4921
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018