Project name: 1HMT_A3D_static

Status: done

Started: 2026-05-31 05:05:44
Settings
Chain sequence(s) A: VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:06)
Show buried residues

Minimal score value
-3.471
Maximal score value
1.1602
Average score
-0.9939
Total score value
-130.201

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A -0.6567
2 D A -1.8573
3 A A -0.6719
4 F A 0.0000
5 L A -1.1084
6 G A -1.3542
7 T A -1.6046
8 W A 0.0000
9 K A -2.4496
10 L A 0.0000
11 V A -0.3098
12 D A -1.4729
13 S A -1.8170
14 K A -2.5736
15 N A -2.2326
16 F A -1.6086
17 D A -2.1256
18 D A -2.0394
19 Y A 0.0000
20 M A 0.0000
21 K A -1.7647
22 S A -1.0553
23 L A -0.9689
24 G A -0.8027
25 V A -0.7916
26 G A -0.0042
27 F A 1.1602
28 A A 0.6722
29 T A 0.3235
30 R A -0.2483
31 Q A -0.1058
32 V A 0.8050
33 A A 0.0512
34 S A -0.3874
35 M A 0.6238
36 T A -0.3173
37 K A -1.6319
38 P A 0.0000
39 T A -1.5855
40 T A 0.0000
41 I A -1.0251
42 I A 0.0000
43 E A -2.7988
44 K A -3.4534
45 N A -2.8195
46 G A -2.4728
47 D A -2.6008
48 I A -1.8833
49 L A 0.0000
50 T A -1.5824
51 L A 0.0000
52 K A -1.6572
53 T A -1.3928
54 H A -1.6498
55 S A -1.0287
56 T A -0.4292
57 F A 0.0027
58 K A -1.3413
59 N A -2.1959
60 T A -1.8940
61 E A -2.2466
62 I A -1.0826
63 S A -0.9421
64 F A 0.0000
65 K A -1.2304
66 L A 0.0190
67 G A 0.2065
68 V A 0.7741
69 E A -1.1746
70 F A -1.3855
71 D A -2.7922
72 E A -2.3843
73 T A -2.1840
74 T A -1.8549
75 A A -1.6270
76 D A -1.8750
77 D A -2.6090
78 R A -2.4353
79 K A -3.2279
80 V A 0.0000
81 K A -2.8228
82 S A 0.0000
83 I A -0.2479
84 V A 0.0000
85 T A 0.0782
86 L A -0.3495
87 D A -1.9283
88 G A -1.6406
89 G A -1.3186
90 K A -1.3043
91 L A 0.0000
92 V A 0.0459
93 H A 0.0000
94 L A -0.2777
95 Q A 0.0000
96 K A -2.6861
97 W A -2.5299
98 D A -2.9071
99 G A -2.1895
100 Q A -2.5724
101 E A -2.8981
102 T A 0.0000
103 T A 0.0250
104 L A 0.4575
105 V A 0.1493
106 R A 0.0000
107 E A -0.6508
108 L A -0.1999
109 I A -0.0514
110 D A -1.6519
111 G A -1.7220
112 K A -1.7473
113 L A 0.0000
114 I A -0.3290
115 L A 0.0000
116 T A 0.3113
117 L A 0.0000
118 T A 0.1829
119 H A -0.6822
120 G A -0.6654
121 T A -0.0461
122 A A -0.1220
123 V A 0.7441
124 C A 0.0000
125 T A -0.5689
126 R A 0.0000
127 T A -0.6788
128 Y A 0.0000
129 E A -2.6603
130 K A -3.4710
131 E A -3.0914
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018