Project name: query_structure

Status: done

Started: 2026-03-17 01:10:51
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGHWPWVWQEFEVPGSKSTATISGLKPGVDYTITVYAAGSYSSYYYYGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-3.3795
Maximal score value
2.6791
Average score
-0.3674
Total score value
-34.9064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6445
2 S A 0.2385
3 D A -0.1257
4 V A -0.5039
5 P A 0.0000
6 R A -3.1889
7 D A -3.3795
8 L A 0.0000
9 E A -2.1041
10 V A 0.1242
11 V A 1.5536
12 A A 0.9079
13 A A 0.3289
14 T A -0.3398
15 P A -1.1224
16 T A -1.0005
17 S A -0.5285
18 L A 0.0000
19 L A 0.7695
20 I A 0.0000
21 S A -1.1509
22 W A 0.0000
23 D A -3.2234
24 A A -1.6453
25 P A -0.5077
26 A A 0.2445
27 V A 0.5695
28 T A -0.1246
29 V A -0.6729
30 D A -1.7628
31 Y A -1.3681
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A -1.1515
36 Y A -0.6778
37 G A 0.0000
38 E A -1.2675
39 T A -1.1310
40 G A -0.8141
41 H A -0.0621
42 W A 1.3603
43 P A 0.9452
44 W A 1.9260
45 V A 1.6825
46 W A 0.2217
47 Q A -1.3769
48 E A -2.2599
49 F A -1.4395
50 E A -1.9001
51 V A 0.0000
52 P A -1.5888
53 G A -1.6420
54 S A -1.4150
55 K A -2.2572
56 S A -1.4374
57 T A -0.7707
58 A A 0.0000
59 T A 0.2436
60 I A 0.0000
61 S A -0.6588
62 G A -1.0297
63 L A 0.0000
64 K A -2.3723
65 P A -1.6712
66 G A -1.4617
67 V A -1.4249
68 D A -2.0620
69 Y A 0.0000
70 T A -1.0268
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.4536
75 A A 0.0000
76 A A 0.0000
77 G A 0.6821
78 S A 1.2178
79 Y A 1.9256
80 S A 0.8320
81 S A 1.0372
82 Y A 2.5025
83 Y A 2.6352
84 Y A 2.6791
85 Y A 2.1122
86 G A 0.8252
87 S A 0.1360
88 P A -0.0004
89 I A -0.2718
90 S A -0.6820
91 I A -0.7410
92 N A -1.7263
93 Y A -1.4608
94 R A -2.5293
95 T A -1.6458
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018