Project name: query_structure

Status: done

Started: 2026-03-17 01:07:18
Settings
Chain sequence(s) A: VQLVESGGDLVQFGGSLRLSCAASAFTFSTYYMTWVRQPPGKGLEWVSGINSDGSTYYRDSVKGRFTISRDNAKNMLYLEMISLKPEDTAVYYCAGGAGNAWLFGDWGQGTMVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:41)
Show buried residues

Minimal score value
-2.7313
Maximal score value
1.9337
Average score
-0.3869
Total score value
-45.2691

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.2917
2 Q A -0.1553
3 L A 0.0000
4 V A 0.4706
5 E A 0.0000
6 S A -0.6783
7 G A -1.1214
8 G A -0.9385
9 D A -1.2050
10 L A 0.7074
11 V A 0.0661
12 Q A -0.2281
13 F A 0.7988
14 G A -0.0031
15 G A 0.1404
16 S A -0.5243
17 L A -1.2395
18 R A -2.4628
19 L A 0.0000
20 S A -0.5513
21 C A 0.0000
22 A A -0.2747
23 A A 0.0000
24 S A -0.0020
25 A A 0.4866
26 F A 0.4838
27 T A 0.0871
28 F A 0.0000
29 S A -0.9286
30 T A -0.5072
31 Y A -0.3288
32 Y A -0.3834
33 M A 0.0000
34 T A 0.0000
35 W A 0.0000
36 V A 0.0000
37 R A 0.0000
38 Q A -0.3423
39 P A 0.0000
40 P A -1.1882
41 G A -1.4237
42 K A -2.0269
43 G A -0.8155
44 L A 0.7146
45 E A 0.1100
46 W A 0.3062
47 V A 0.0000
48 S A 0.0000
49 G A 0.0000
50 I A 0.0000
51 N A -1.1337
52 S A -1.5151
53 D A -2.0949
54 G A -1.3304
55 S A -0.7039
56 T A 0.0130
57 Y A 0.2791
58 Y A -0.7754
59 R A -1.8294
60 D A -2.7313
61 S A -1.8762
62 V A 0.0000
63 K A -2.7034
64 G A -1.6409
65 R A -1.0630
66 F A 0.0000
67 T A -0.8682
68 I A 0.0000
69 S A -0.5866
70 R A -0.9837
71 D A -1.4611
72 N A -1.7465
73 A A -1.4081
74 K A -2.2060
75 N A -1.5317
76 M A -0.8668
77 L A 0.0000
78 Y A -0.7205
79 L A 0.0000
80 E A -1.7841
81 M A 0.0000
82 I A 0.0355
83 S A -0.0155
84 L A 0.0000
85 K A -1.0851
86 P A -1.1782
87 E A -1.9828
88 D A 0.0000
89 T A -0.6978
90 A A 0.0000
91 V A 0.4299
92 Y A 0.0000
93 Y A 0.3911
94 C A 0.0000
95 A A 0.0000
96 G A 0.0000
97 G A 0.0000
98 A A -0.0348
99 G A -0.6786
100 N A -0.9108
101 A A 0.4135
102 W A 1.6424
103 L A 1.9337
104 F A 1.2546
105 G A 0.6539
106 D A 0.4342
107 W A 0.4202
108 G A -0.0887
109 Q A -0.9566
110 G A 0.0000
111 T A -0.1682
112 M A 0.3194
113 V A 0.0000
114 T A -0.0279
115 V A 0.0000
116 S A -0.1030
117 S A -0.3351
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018