Project name: cbbbf11e9f4847b

Status: done

Started: 2026-07-01 15:23:28
Settings
Chain sequence(s) B: ESNLIQDHTLQVSAGGPLSSVTFVWGDDATLTVPLTLPAGASVRLRAETA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:12)
Show buried residues

Minimal score value
-3.4469
Maximal score value
1.9815
Average score
-0.7315
Total score value
-36.5757

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -2.0962
2 S B -1.3265
3 N B -1.7200
4 L B -1.1600
5 I B 0.0968
6 Q B -1.8701
7 D B -3.4469
8 H B -2.8325
9 T B -1.8597
10 L B -0.9416
11 Q B -1.5392
12 V B 0.0000
13 S B -0.7988
14 A B -0.6685
15 G B -0.6808
16 G B -0.6029
17 P B -0.4582
18 L B -0.1984
19 S B -0.1027
20 S B 0.1020
21 V B 0.0000
22 T B 1.1403
23 F B 1.9815
24 V B 1.8859
25 W B 0.6891
26 G B -0.9537
27 D B -2.3826
28 D B -2.2579
29 A B -0.3195
30 T B 0.8738
31 L B 1.7545
32 T B 1.0292
33 V B 0.8192
34 P B 0.2287
35 L B 0.2933
36 T B -0.0019
37 L B 0.0000
38 P B -0.6445
39 A B -0.7686
40 G B -0.9218
41 A B -0.5870
42 S B -0.9649
43 V B -1.0307
44 R B -2.6694
45 L B -2.5397
46 R B -3.4236
47 A B -1.8831
48 E B -2.2036
49 T B -1.0012
50 A B -0.6133
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018