Project name: query_structure

Status: done

Started: 2026-03-17 01:10:38
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDLYYITYGETGWWYPSSYQEFAVPGSKSTATISGLKPGVDYTITVYAESGWGYDVSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:29)
Show buried residues

Minimal score value
-3.4313
Maximal score value
2.0911
Average score
-0.4326
Total score value
-40.6598

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6556
2 S A 0.3430
3 D A -0.1205
4 V A -0.1886
5 P A 0.0000
6 R A -3.1866
7 D A -3.4313
8 L A 0.0000
9 E A -2.1313
10 V A 0.1028
11 V A 1.5424
12 A A 0.8978
13 A A 0.3121
14 T A -0.5342
15 P A -1.1374
16 T A -1.0064
17 S A -0.5346
18 L A 0.0000
19 L A 0.7461
20 I A 0.0000
21 S A -1.1410
22 W A 0.0000
23 D A -3.2529
24 A A -1.7093
25 P A -0.5372
26 A A 0.2742
27 V A 0.3146
28 T A -0.4196
29 V A 0.0000
30 D A -1.7570
31 L A -0.4110
32 Y A 0.0000
33 Y A 0.2918
34 I A 0.0000
35 T A -0.8835
36 Y A -0.8040
37 G A 0.0000
38 E A -0.8643
39 T A -0.5143
40 G A 0.3582
41 W A 1.7322
42 W A 2.0911
43 Y A 2.0526
44 P A 0.7214
45 S A 0.0926
46 S A 0.1592
47 Y A -0.4789
48 Q A -1.8855
49 E A -1.9964
50 F A -0.4606
51 A A -0.0816
52 V A 0.0000
53 P A -0.9571
54 G A -1.2252
55 S A -1.3186
56 K A -2.1305
57 S A -1.4306
58 T A -0.7607
59 A A 0.0000
60 T A 0.2393
61 I A 0.0000
62 S A -0.6568
63 G A -1.0308
64 L A 0.0000
65 K A -2.3472
66 P A -1.6481
67 G A -1.4168
68 V A -1.3292
69 D A -1.9041
70 Y A 0.0000
71 T A -0.7313
72 I A 0.0000
73 T A -0.2990
74 V A 0.0000
75 Y A 0.3866
76 A A 0.0000
77 E A -0.0425
78 S A 0.0000
79 G A 0.0116
80 W A 0.7051
81 G A 0.3433
82 Y A 0.9583
83 D A -0.5411
84 V A 1.0078
85 S A 0.0000
86 S A -0.1073
87 P A -0.0300
88 I A -0.4195
89 S A -0.4556
90 I A -0.7511
91 N A -1.6732
92 Y A -1.3825
93 R A -2.4587
94 T A -1.4840
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018