Project name: cc3dfc8a027316e

Status: done

Started: 2026-07-01 15:22:30
Settings
Chain sequence(s) B: METVSITRVVTPELAGQLFRWGFSSSPSTEALEESARKNEEVFTLRLVPP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-4.2203
Maximal score value
1.8159
Average score
-0.6022
Total score value
-30.1116

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.1955
2 E B -1.1349
3 T B -0.0112
4 V B 1.0932
5 S B 0.9192
6 I B 1.6090
7 T B 0.4445
8 R B -0.1067
9 V B 1.4582
10 V B 1.4500
11 T B 0.0544
12 P B -0.8594
13 E B -1.7732
14 L B -0.7227
15 A B -0.5395
16 G B -1.0023
17 Q B -0.7271
18 L B 1.5264
19 F B 1.0037
20 R B -0.9463
21 W B -0.2462
22 G B -0.5126
23 F B 1.4326
24 S B 0.2551
25 S B 0.1992
26 S B -0.1531
27 P B -0.4203
28 S B -1.0915
29 T B -1.5248
30 E B -2.7560
31 A B -1.7528
32 L B -1.2874
33 E B -3.5007
34 E B -3.8094
35 S B -2.4215
36 A B -2.6244
37 R B -4.2203
38 K B -3.8942
39 N B -3.1641
40 E B -3.2187
41 E B -2.4357
42 V B 0.3506
43 F B 1.8159
44 T B 0.9512
45 L B 0.0713
46 R B -0.7882
47 L B 0.5125
48 V B 1.5828
49 P B 0.4358
50 P B 0.1725
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018