Project name: B22

Status: done

Started: 2026-07-24 04:48:36
Settings
Chain sequence(s) A: ESGGGLVQPGGSLRLSCAASGSFFAIYTMGWHRQVPGQQRELVATIASDGSTNYANFVKGRFTISRDNNMVYLQMNSLKPEDTAVYYCNADLGITFGTEGTRVFGAWGQGTQVTVTS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-3.0139
Maximal score value
2.037
Average score
-0.6916
Total score value
-80.92

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.2289
2 S A -1.7616
3 G A -1.2953
4 G A -1.2225
5 G A -0.0858
6 L A 0.9747
7 V A -0.0801
8 Q A -1.3811
9 P A -2.0539
10 G A -1.7314
11 G A -1.4456
12 S A -1.7147
13 L A -1.3011
14 R A -2.1483
15 L A 0.0000
16 S A -0.9250
17 C A 0.0000
18 A A -0.6805
19 A A -0.3395
20 S A -0.3937
21 G A -0.7534
22 S A -0.1011
23 F A 0.7818
24 F A 0.0000
25 A A 0.1091
26 I A 2.0370
27 Y A 1.3773
28 T A 0.5057
29 M A 0.0000
30 G A 0.0000
31 W A 0.0000
32 H A 0.0000
33 R A -0.8528
34 Q A -1.3304
35 V A -1.2440
36 P A -1.0563
37 G A -1.4907
38 Q A -2.3801
39 Q A -2.5260
40 R A -2.1491
41 E A -1.0678
42 L A 0.0154
43 V A 0.0000
44 A A 0.0000
45 T A -0.4124
46 I A 0.0000
47 A A -0.8921
48 S A -0.5222
49 D A -1.8210
50 G A -1.6107
51 S A -1.2709
52 T A -1.0861
53 N A -1.6199
54 Y A -1.2223
55 A A -0.9634
56 N A -1.6384
57 F A -0.4591
58 V A 0.0000
59 K A -2.4828
60 G A -1.8551
61 R A -1.9737
62 F A 0.0000
63 T A -1.2468
64 I A 0.0000
65 S A -0.9268
66 R A -1.9764
67 D A -2.7378
68 N A -2.4344
69 N A -1.5213
70 M A -1.0403
71 V A 0.0000
72 Y A -0.6188
73 L A 0.0000
74 Q A -1.5320
75 M A 0.0000
76 N A -2.3936
77 S A -1.8529
78 L A 0.0000
79 K A -3.0139
80 P A -2.1404
81 E A -2.4501
82 D A 0.0000
83 T A -0.9142
84 A A 0.0000
85 V A -0.6464
86 Y A 0.0000
87 Y A -0.5374
88 C A 0.0000
89 N A 0.0000
90 A A 0.0000
91 D A 0.0000
92 L A 1.6522
93 G A 0.9655
94 I A 1.2761
95 T A 0.4737
96 F A 1.1594
97 G A -0.0235
98 T A -0.7710
99 E A -2.0324
100 G A -1.4683
101 T A -0.7206
102 R A -0.6801
103 V A 0.9595
104 F A 1.4034
105 G A 0.7897
106 A A 0.6353
107 W A 0.2787
108 G A -0.8100
109 Q A -1.6832
110 G A -1.2637
111 T A 0.0000
112 Q A -1.3039
113 V A 0.0000
114 T A -0.4649
115 V A 0.0000
116 T A -0.7027
117 S A -0.8359
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018