Project name: query_structure

Status: done

Started: 2026-03-17 00:50:58
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVYWNNMYWYRQAPGKEREWVAAINSSGKYTHYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDNGAWWYYYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-3.7364
Maximal score value
2.6815
Average score
-0.6778
Total score value
-81.3386

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4613
2 V A -0.7863
3 Q A -0.9122
4 L A 0.0000
5 V A 0.9760
6 E A 0.0000
7 S A -0.6090
8 G A -1.0677
9 G A -0.8632
10 G A -0.0911
11 L A 0.9209
12 V A 0.0000
13 Q A -1.3552
14 A A -1.5916
15 G A -1.4959
16 G A -1.0529
17 S A -1.4693
18 L A -1.1166
19 R A -2.3209
20 L A 0.0000
21 S A -0.4490
22 C A 0.0000
23 A A -0.1306
24 A A 0.0000
25 S A -0.6554
26 G A -0.9582
27 F A -0.0178
28 P A 0.0593
29 V A 0.0000
30 Y A 1.0497
31 W A 1.3196
32 N A 0.0315
33 N A -0.4742
34 M A 0.0000
35 Y A 0.0287
36 W A 0.0000
37 Y A -0.4662
38 R A -1.3898
39 Q A -2.3066
40 A A -2.1487
41 P A -1.4947
42 G A -2.0067
43 K A -3.4684
44 E A -3.7364
45 R A -3.0960
46 E A -2.0595
47 W A -0.6418
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 N A -0.4632
53 S A 0.0286
54 S A -0.3102
55 G A -0.8782
56 K A -1.2532
57 Y A 0.0425
58 T A -0.3715
59 H A -1.0742
60 Y A -1.3306
61 A A -1.5650
62 D A -2.5521
63 S A -1.7766
64 V A 0.0000
65 K A -2.7894
66 G A -1.8795
67 R A -1.7756
68 F A 0.0000
69 T A -1.1818
70 I A 0.0000
71 S A -0.6880
72 R A -1.2271
73 D A -1.7341
74 N A -1.7631
75 A A -1.5112
76 K A -2.4112
77 N A -1.5408
78 T A -0.9467
79 V A 0.0000
80 Y A -0.7472
81 L A 0.0000
82 Q A -1.6402
83 M A 0.0000
84 N A -1.9853
85 S A -1.4626
86 L A 0.0000
87 K A -2.6881
88 P A -2.0924
89 E A -2.4543
90 D A 0.0000
91 T A -1.0693
92 A A 0.0000
93 V A -0.7299
94 Y A 0.0000
95 Y A -0.2111
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -1.2760
100 D A -1.0637
101 N A -1.7348
102 G A -0.4914
103 A A 0.7024
104 W A 2.0555
105 W A 2.6815
106 Y A 2.6637
107 Y A 1.8448
108 Y A 0.9833
109 D A -0.5831
110 Y A -0.2877
111 W A -0.0067
112 G A -0.0836
113 Q A -0.9461
114 G A 0.0000
115 T A 0.0000
116 Q A -1.2037
117 V A 0.0000
118 T A -0.4039
119 V A 0.0000
120 S A -0.8490
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018