Project name: query_structure

Status: done

Started: 2026-03-16 20:08:39
Settings
Chain sequence(s) A: EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:24)
Show buried residues

Minimal score value
-3.6679
Maximal score value
0.1413
Average score
-1.4902
Total score value
-59.6079

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.4302
2 D A -2.1670
3 C A -0.8482
4 I A -0.6933
5 P A -1.0004
6 K A -1.7315
7 W A -0.3807
8 K A -1.3112
9 G A -0.5165
10 C A 0.0000
11 V A -0.5085
12 N A -2.2418
13 R A -3.0363
14 H A -2.0565
15 G A -1.9959
16 D A -2.3368
17 C A -1.8993
18 C A -1.1844
19 E A -2.3458
20 G A -1.8559
21 L A 0.0000
22 E A -1.6831
23 C A -0.8616
24 W A -0.1546
25 K A -2.3898
26 R A -3.4157
27 R A -3.6679
28 R A -3.2357
29 S A -1.5622
30 F A 0.1413
31 E A -0.9212
32 V A 0.0000
33 C A 0.0000
34 V A -1.0148
35 P A -1.7327
36 K A -2.4924
37 T A -1.4988
38 P A -1.5424
39 K A -2.0498
40 T A -0.9863
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018