Project name: ccf989b06c795c0

Chain sequence(s)	A: KKFGEAFKLADKDGSGEVTAEELRAALRESGAVSEVAADEIYEAARKLSPDGKISRAQFRVLTSPYRPSI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)

• Minimal score value: -3.4877
• Maximal score value: 1.7783
• Average score: -1.473
• Total score value: -103.1083

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-3.0432
2	K	A	-3.3345
3	F	A	0.0000
4	G	A	-3.0623
5	E	A	-3.4788
6	A	A	0.0000
7	F	A	0.0000
8	K	A	-3.3206
9	L	A	-1.9957
10	A	A	0.0000
11	D	A	-3.1365
12	K	A	-3.3418
13	D	A	-3.3123
14	G	A	-2.4993
15	S	A	-2.1151
16	G	A	-2.3440
17	E	A	-3.0972
18	V	A	0.0000
19	T	A	-2.1760
20	A	A	0.0000
21	E	A	-2.4048
22	E	A	-2.0635
23	L	A	0.0000
24	R	A	-2.7753
25	A	A	-2.1424
26	A	A	0.0000
27	L	A	0.0000
28	R	A	-3.4877
29	E	A	-3.2484
30	S	A	-2.6426
31	G	A	-2.0213
32	A	A	-2.3093
33	V	A	-1.3535
34	S	A	-0.9258
35	E	A	-2.4971
36	V	A	-0.2050
37	A	A	0.0000
38	A	A	0.0000
39	D	A	-2.9932
40	E	A	-2.6558
41	I	A	0.0000
42	Y	A	-2.3858
43	E	A	-3.0063
44	A	A	-1.6936
45	A	A	0.0000
46	R	A	-2.5305
47	K	A	-1.9391
48	L	A	-0.2544
49	S	A	-1.3633
50	P	A	-1.9064
51	D	A	-2.6648
52	G	A	0.0000
53	K	A	-2.8801
54	I	A	0.0000
55	S	A	-2.2495
56	R	A	-2.9459
57	A	A	-1.4184
58	Q	A	-1.1755
59	F	A	0.0000
60	R	A	-1.6383
61	V	A	0.4421
62	L	A	0.0000
63	T	A	0.0000
64	S	A	-0.2661
65	P	A	-0.2008
66	Y	A	-0.0294
67	R	A	-1.0085
68	P	A	-0.3639
69	S	A	0.5749
70	I	A	1.7783