Project name: 2303_4

Status: done

Started: 2026-05-21 08:42:53
Settings
Chain sequence(s) A: PLGLRNFCFAGDDRGHTRDIADRLAAAAPELTVHRVPYSLGPDAYLQAIRDAAAAGADVVVLGGSWPSVYDEARAALDGGAKRVIGIAGPDRIEDPATRAAVDRVKRELPEFSLQFFADEGAARDRDIDAFVAQLLAWAGRS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:25)
Show buried residues

Minimal score value
-4.1148
Maximal score value
0.8251
Average score
-1.1497
Total score value
-163.2568

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.3079
2 L A 0.8251
3 G A -0.3778
4 L A 0.0000
5 R A -2.2970
6 N A -1.4515
7 F A 0.0000
8 C A 0.0000
9 F A 0.0000
10 A A 0.0000
11 G A -0.9014
12 D A 0.0000
13 D A -2.1175
14 R A -2.6401
15 G A -2.0702
16 H A -1.7424
17 T A 0.0000
18 R A -2.6867
19 D A -2.2876
20 I A 0.0000
21 A A 0.0000
22 D A -2.5019
23 R A -1.9356
24 L A 0.0000
25 A A -1.0547
26 A A -0.8749
27 A A -0.8606
28 A A 0.0000
29 P A -1.2580
30 E A -2.0648
31 L A -1.4716
32 T A -0.8069
33 V A -0.9805
34 H A -1.1474
35 R A -2.1755
36 V A 0.0000
37 P A -0.6720
38 Y A 0.1068
39 S A 0.1962
40 L A 0.1875
41 G A -0.4878
42 P A -1.0266
43 D A -1.9205
44 A A -1.0974
45 Y A 0.0000
46 L A -1.2405
47 Q A -1.6163
48 A A -1.4558
49 I A 0.0000
50 R A -2.0169
51 D A -2.1011
52 A A 0.0000
53 A A 0.0000
54 A A -1.1187
55 A A -0.7182
56 G A -0.8074
57 A A 0.0000
58 D A -1.5127
59 V A 0.0000
60 V A 0.0000
61 V A 0.0000
62 L A 0.0000
63 G A 0.0135
64 G A 0.0000
65 S A -1.0732
66 W A 0.0947
67 P A -0.4059
68 S A -0.4039
69 V A 0.0000
70 Y A -1.3745
71 D A -1.8666
72 E A 0.0000
73 A A 0.0000
74 R A -1.7969
75 A A 0.0000
76 A A 0.0000
77 L A -1.8901
78 D A -2.4367
79 G A -2.0201
80 G A -1.7696
81 A A 0.0000
82 K A -2.2503
83 R A -1.9510
84 V A 0.0000
85 I A 0.0000
86 G A 0.0000
87 I A 0.0000
88 A A 0.0000
89 G A -1.7042
90 P A -1.8021
91 D A -3.6634
92 R A -3.6210
93 I A 0.0000
94 E A -4.1148
95 D A -3.4617
96 P A -1.8196
97 A A -1.0370
98 T A 0.0000
99 R A -2.5790
100 A A -1.5184
101 A A 0.0000
102 V A 0.0000
103 D A -2.4114
104 R A -3.0217
105 V A 0.0000
106 K A -3.6283
107 R A -3.7911
108 E A -3.1546
109 L A -2.1964
110 P A -1.9586
111 E A -2.0156
112 F A 0.0000
113 S A -0.8914
114 L A -0.1116
115 Q A -0.0850
116 F A 0.0532
117 F A 0.0000
118 A A -2.1315
119 D A -3.1985
120 E A -3.3761
121 G A -2.4322
122 A A -1.9999
123 A A -2.5707
124 R A -3.6884
125 D A -3.8125
126 R A -3.4396
127 D A -2.4501
128 I A 0.0000
129 D A -3.1354
130 A A -1.9330
131 F A 0.0000
132 V A 0.0000
133 A A -1.1966
134 Q A -1.3690
135 L A 0.0000
136 L A 0.0000
137 A A -1.0071
138 W A -0.5297
139 A A 0.0000
140 G A -1.5152
141 R A -2.1596
142 S A -1.1586
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018