Project name: cd9ade9e4f2a298

Chain sequence(s)	O: QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Selected Chain(s)	O
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with O chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)

• Minimal score value: -2.7191
• Maximal score value: 1.7344
• Average score: -1.0055
• Total score value: -31.1713

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
244	Q	O	-1.2550
245	T	O	-0.4530
246	A	O	0.2754
247	P	O	0.3791
248	V	O	1.7344
249	P	O	0.8238
250	M	O	0.7986
251	P	O	-0.3141
252	D	O	-1.6399
253	L	O	-0.1877
254	K	O	-1.7421
255	N	O	-1.3495
256	V	O	0.0990
257	K	O	-1.3755
258	S	O	-1.0986
259	K	O	-1.2498
260	I	O	0.0207
261	G	O	-0.6192
262	S	O	-0.9347
263	T	O	-1.2215
264	E	O	-2.4054
265	N	O	-2.3779
266	L	O	-1.0683
267	K	O	-2.4621
268	H	O	-2.7191
269	Q	O	-2.3669
270	P	O	-1.8903
271	G	O	-1.4754
272	G	O	-1.4724
273	G	O	-1.6086
274	K	O	-2.0153