Project name: cd9ce9eef0455fe

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMGWFRQAPGQGLEAVAATSSGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASGLAGEMTETSSSDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -2.9324
• Maximal score value: 1.6986
• Average score: -0.5788
• Total score value: -71.1899

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5148
2	V	A	-0.9402
3	Q	A	-1.0208
4	L	A	0.0000
5	V	A	1.1489
6	E	A	0.4043
7	S	A	-0.1264
8	G	A	-0.7260
9	G	A	0.1005
10	G	A	0.6996
11	L	A	1.4211
12	V	A	-0.0836
13	Q	A	-1.4468
14	P	A	-1.8514
15	G	A	-1.5710
16	G	A	-1.0598
17	S	A	-1.3170
18	L	A	-0.9076
19	R	A	-2.1403
20	L	A	0.0000
21	S	A	-0.4047
22	C	A	0.0000
23	A	A	-0.1402
24	A	A	0.0000
25	S	A	-0.9058
26	G	A	-1.0315
27	F	A	-0.3574
28	T	A	-0.2163
29	F	A	0.0000
30	S	A	-0.7182
31	S	A	-0.2645
32	Y	A	0.2113
33	G	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.2800
38	R	A	-0.0651
39	Q	A	-0.4946
40	A	A	-0.9080
41	P	A	-0.9960
42	G	A	-1.2180
43	Q	A	-1.7065
44	G	A	-0.9309
45	L	A	0.2387
46	E	A	-0.4863
47	A	A	0.1152
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.4371
51	T	A	0.0000
52	S	A	-0.5975
53	S	A	-0.6388
54	G	A	-1.0477
55	G	A	-1.0477
56	G	A	-0.8711
57	S	A	-0.4472
58	T	A	0.2645
59	Y	A	0.8752
60	Y	A	-0.2051
61	A	A	0.0000
62	D	A	-2.3438
63	S	A	-1.7603
64	V	A	0.0000
65	K	A	-2.4517
66	G	A	-1.7519
67	R	A	-1.5248
68	F	A	0.0000
69	T	A	-0.7068
70	I	A	0.0000
71	S	A	-0.5461
72	R	A	-1.2940
73	D	A	-1.9863
74	N	A	-2.0996
75	S	A	-1.7599
76	K	A	-2.5191
77	N	A	-1.8766
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6628
81	L	A	0.0000
82	Q	A	-1.2902
83	M	A	0.0000
84	N	A	-1.5467
85	S	A	-1.4254
86	L	A	0.0000
87	R	A	-2.9324
88	A	A	-2.0232
89	E	A	-2.4660
90	D	A	0.0000
91	T	A	-0.5196
92	A	A	0.0000
93	V	A	0.8512
94	Y	A	0.0000
95	Y	A	0.4823
96	C	A	0.0000
97	A	A	0.0000
98	S	A	0.0000
99	G	A	0.0000
100	L	A	-0.2705
101	A	A	-0.8286
102	G	A	-1.0380
103	E	A	-1.7879
104	M	A	-0.3872
105	T	A	-1.1603
106	E	A	-1.9498
107	T	A	-1.1377
108	S	A	-1.0622
109	S	A	-0.9573
110	S	A	-0.9782
111	D	A	-1.5488
112	Y	A	-0.4126
113	W	A	0.0794
114	G	A	-0.1360
115	Q	A	-0.8116
116	G	A	0.1352
117	T	A	0.6044
118	L	A	1.6986
119	V	A	0.0000
120	T	A	0.3352
121	V	A	0.0000
122	S	A	-0.7399
123	S	A	-0.4740