Project name: E64F

Status: done

Started: 2026-07-07 06:38:43
Settings
Chain sequence(s) A: TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERFHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:46)
Show buried residues

Minimal score value
-3.3729
Maximal score value
2.0405
Average score
-1.0568
Total score value
-181.7622

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
5 T A -0.4954
6 S A -0.9722
7 Q A -0.9563
8 V A -0.2536
9 R A -1.4708
10 Q A -1.9770
11 N A -2.6131
12 Y A 0.0000
13 H A -2.4416
14 Q A -2.4769
15 D A -2.4485
16 S A 0.0000
17 E A -1.5250
18 A A -1.2231
19 A A -1.3313
20 I A 0.0000
21 N A -0.2439
22 R A -1.0709
23 Q A 0.0000
24 I A 0.0000
25 N A -0.5146
26 L A -0.3132
27 E A 0.0000
28 L A -0.0465
29 Y A -0.1164
30 A A 0.0000
31 S A 0.0000
32 Y A 0.3541
33 V A 0.0000
34 Y A 0.0000
35 L A 0.8651
36 S A 0.0325
37 M A 0.0000
38 S A 0.0000
39 Y A 0.3075
40 Y A 0.0000
41 F A 0.0000
42 D A -2.8577
43 R A -2.9395
44 D A -3.3729
45 D A -3.0031
46 V A -1.9802
47 A A -1.8390
48 L A -1.6745
49 K A -2.3819
50 N A -1.7740
51 F A 0.0000
52 A A 0.0000
53 K A -1.7363
54 Y A -0.9148
55 F A 0.0000
56 L A -0.4076
57 H A -1.5555
58 Q A -1.0453
59 S A 0.0000
60 H A -1.1230
61 E A -1.2311
62 E A 0.0000
63 R A -0.7480
64 F A 0.2958
65 H A 0.0000
66 A A 0.0000
67 E A -2.0581
68 K A -1.7145
69 L A 0.0000
70 M A -1.6747
71 K A -2.9792
72 L A 0.0000
73 Q A 0.0000
74 N A -2.6486
75 Q A -2.3559
76 R A -2.1135
77 G A 0.0000
78 G A 0.0000
79 R A -1.3962
80 I A 0.5006
81 F A 2.0405
82 L A 1.2934
83 Q A -1.1541
84 D A -2.3009
85 I A -1.2191
86 Q A -2.4806
87 K A -2.8267
88 P A -1.9978
89 D A -2.8152
90 C A -2.4157
91 D A -3.3174
92 D A -3.3037
93 W A 0.0000
94 E A -2.6581
95 S A -1.7072
96 G A 0.0000
97 L A 0.0000
98 N A -1.3471
99 A A 0.0000
100 M A 0.0000
101 E A -1.2625
102 C A -0.7315
103 A A 0.0000
104 L A -1.4332
105 H A -1.8219
106 L A 0.0000
107 E A 0.0000
108 K A -2.2524
109 N A -2.4561
110 V A 0.0000
111 N A -1.4499
112 Q A -2.1181
113 S A 0.0000
114 L A 0.0000
115 L A -1.3994
116 E A -2.4105
117 L A 0.0000
118 H A -2.1326
119 K A -2.8599
120 L A -2.3352
121 A A 0.0000
122 T A -2.4757
123 D A -2.9320
124 K A -3.0196
125 N A -2.7405
126 D A 0.0000
127 P A -1.6175
128 H A -1.7792
129 L A 0.0000
130 C A -1.8346
131 D A -2.4636
132 F A -1.3665
133 I A 0.0000
134 E A -2.1249
135 T A -1.4958
136 H A -1.3138
137 Y A 0.0000
138 L A -0.7788
139 N A -1.1294
140 E A -1.1506
141 Q A 0.0000
142 V A -0.1271
143 K A -1.9825
144 A A -1.4506
145 I A -1.4486
146 K A -2.5148
147 E A -2.4834
148 L A 0.0000
149 G A -1.8557
150 D A -2.0882
151 H A -1.7030
152 V A -1.5900
153 T A -1.5238
154 N A -1.5350
155 L A 0.0000
156 R A -2.4993
157 K A -2.3321
158 M A -1.0285
159 G A -1.3848
160 A A 0.0000
161 P A -1.6351
162 E A -2.0325
163 S A -0.7482
164 G A 0.0128
165 L A 1.5407
166 A A 0.0000
167 E A 0.2968
168 Y A 1.0757
169 L A 0.6289
170 F A 0.0000
171 D A 0.0000
172 K A -1.7209
173 H A -1.4515
174 T A -0.9118
175 L A -0.9978
176 G A -1.5167
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018