Project name: query_structure

Status: done

Started: 2026-03-16 23:09:33
Settings
Chain sequence(s) A: ESCVLIPCISGVIGCSCSSMICYFNGSQSCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:07)
Show buried residues

Minimal score value
-1.6938
Maximal score value
3.1238
Average score
1.0337
Total score value
32.0437

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.6938
2 S A -0.2962
3 C A 1.0257
4 V A 2.5292
5 L A 3.1145
6 I A 2.8034
7 P A 2.0187
8 C A 2.5518
9 I A 3.0286
10 S A 2.3768
11 G A 2.2969
12 V A 3.1238
13 I A 3.0057
14 G A 1.0096
15 C A 1.1389
16 S A 0.4972
17 C A 1.1313
18 S A 0.3732
19 S A 0.5471
20 M A 1.6618
21 I A 1.7145
22 C A 0.0000
23 Y A 0.2704
24 F A 0.3005
25 N A -1.1902
26 G A -0.9203
27 S A -0.6015
28 Q A -0.1384
29 S A 0.3214
30 C A 0.2970
31 G A -0.2539
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018