Project name: cf30d1be8095fbe

Status: done

Started: 2026-06-01 14:27:10
Settings
Chain sequence(s) A: EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYIMGWFRQAPGKEREFVAAISQNGIRIYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAASHSAWYTQGFEYDYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)
Show buried residues

Minimal score value
-3.3404
Maximal score value
1.4055
Average score
-0.7416
Total score value
-91.9565

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.6934
2 V A 0.0000
3 Q A -1.7597
4 L A 0.0000
5 V A 1.1790
6 E A 0.0000
7 S A -0.5041
8 G A -1.0092
9 G A -0.8072
10 G A -0.0873
11 L A 0.9493
12 V A 0.0000
13 Q A -1.2865
14 A A -1.4267
15 G A -1.3156
16 G A -0.9194
17 S A -1.2942
18 L A -1.0760
19 R A -2.1583
20 L A 0.0000
21 S A -0.3809
22 C A 0.0000
23 A A -0.1915
24 A A 0.0000
25 S A -1.5630
26 G A -2.3386
27 R A -3.0322
28 T A -1.6732
29 F A 0.0000
30 S A -1.8086
31 N A -2.1404
32 Y A 0.0000
33 I A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.9405
40 A A -1.8003
41 P A -1.2619
42 G A -1.7493
43 K A -2.8491
44 E A -3.3404
45 R A -2.7369
46 E A -1.7601
47 F A -0.7614
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A 0.0000
53 Q A -1.5751
54 N A -1.6029
55 G A -0.4665
56 I A 0.8247
57 R A -0.6510
58 I A 0.6925
59 Y A 0.1468
60 Y A -0.4620
61 A A -1.2366
62 D A -2.4474
63 S A -1.8042
64 V A 0.0000
65 K A -2.5910
66 G A -1.8100
67 R A -1.7127
68 F A 0.0000
69 T A -0.7252
70 I A 0.0000
71 S A -0.1293
72 R A -1.3508
73 D A -1.9711
74 N A -2.2243
75 A A -1.5140
76 K A -2.4350
77 N A -2.1896
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6283
81 L A 0.0000
82 Q A -1.2926
83 M A 0.0000
84 N A -1.5013
85 S A -1.2050
86 L A 0.0000
87 K A -2.0592
88 P A -1.7242
89 E A -2.2153
90 D A 0.0000
91 T A -0.8516
92 A A 0.0000
93 V A -0.4608
94 Y A 0.0000
95 Y A -0.1761
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 S A -1.3494
101 H A -1.3742
102 S A 0.0000
103 A A 0.3076
104 W A 1.0783
105 Y A 0.0000
106 T A 0.3927
107 Q A 0.2514
108 G A 0.1705
109 F A 1.4055
110 E A 0.0950
111 Y A 0.0000
112 D A -1.5067
113 Y A -0.8731
114 W A -0.2395
115 G A -0.1054
116 Q A -0.9554
117 G A -0.4741
118 T A -0.6403
119 Q A -1.0761
120 V A 0.0000
121 T A -0.3128
122 V A 0.0000
123 S A -0.8131
124 S A -1.0507
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018