Project name: cf356c386399e96

Chain sequence(s)	A: MQVQLVESGGGSVQAGGSLRLSCTASGTKELKYAAFDLGWFRQAPGQEREAVAAIDRDGGITYYADSVKGRFTISRDNAKNTVTLQMNNLKPVDTAIYYCAARRSRNRTYESWGQGTQVTVSGGGGSHHHHHHLEYPYDVPDYA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:30)

• Minimal score value: -3.7447
• Maximal score value: 1.3119
• Average score: -0.95
• Total score value: -136.7968

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.0394
2	Q	A	-1.4428
3	V	A	0.0000
4	Q	A	-1.1693
5	L	A	0.0000
6	V	A	1.1286
7	E	A	0.1221
8	S	A	-0.5658
9	G	A	-1.3297
10	G	A	-1.2587
11	G	A	-0.9541
12	S	A	-0.7639
13	V	A	-0.9512
14	Q	A	-2.0151
15	A	A	-1.8011
16	G	A	-2.0336
17	G	A	-1.5621
18	S	A	-1.8470
19	L	A	-1.6166
20	R	A	-2.3999
21	L	A	0.0000
22	S	A	-0.5628
23	C	A	0.0000
24	T	A	-0.1757
25	A	A	0.0000
26	S	A	-0.8548
27	G	A	-1.0204
28	T	A	-0.7410
29	K	A	-1.2047
30	E	A	-0.7745
31	L	A	-0.2053
32	K	A	-1.5577
33	Y	A	0.0000
34	A	A	-1.4247
35	A	A	-1.4746
36	F	A	0.0000
37	D	A	-1.4025
38	L	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	-0.2592
42	R	A	0.0000
43	Q	A	-2.0192
44	A	A	-1.2920
45	P	A	-1.2568
46	G	A	-1.7693
47	Q	A	-2.9915
48	E	A	-3.7447
49	R	A	-3.0581
50	E	A	-2.2630
51	A	A	-0.8372
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.6176
55	I	A	0.0000
56	D	A	0.0000
57	R	A	-2.0097
58	D	A	-2.4769
59	G	A	-1.4643
60	G	A	-0.6128
61	I	A	0.9054
62	T	A	1.0899
63	Y	A	1.3119
64	Y	A	-0.1862
65	A	A	-1.0876
66	D	A	-2.3325
67	S	A	-1.3387
68	V	A	0.0000
69	K	A	-2.4426
70	G	A	-1.9671
71	R	A	-2.0620
72	F	A	0.0000
73	T	A	-0.9159
74	I	A	0.0000
75	S	A	-0.5234
76	R	A	-1.5758
77	D	A	-1.9988
78	N	A	-2.4786
79	A	A	-1.3583
80	K	A	-2.1416
81	N	A	-1.5849
82	T	A	-0.9986
83	V	A	0.0000
84	T	A	-0.8506
85	L	A	0.0000
86	Q	A	-1.7117
87	M	A	0.0000
88	N	A	-2.5400
89	N	A	-2.4857
90	L	A	0.0000
91	K	A	-1.6287
92	P	A	-0.3184
93	V	A	1.2333
94	D	A	0.0000
95	T	A	0.0155
96	A	A	0.0000
97	I	A	-0.4108
98	Y	A	0.0000
99	Y	A	-0.1416
100	C	A	0.0000
101	A	A	0.0000
102	A	A	0.0000
103	R	A	-2.3149
104	R	A	-2.8525
105	S	A	-2.2551
106	R	A	-3.0146
107	N	A	-3.1354
108	R	A	-3.0590
109	T	A	-2.0670
110	Y	A	-1.6087
111	E	A	-2.3986
112	S	A	-1.3538
113	W	A	-0.2649
114	G	A	-0.1429
115	Q	A	-0.9554
116	G	A	-0.5010
117	T	A	0.0000
118	Q	A	-1.4074
119	V	A	0.0000
120	T	A	-0.6218
121	V	A	0.0000
122	S	A	-1.2190
123	G	A	-1.6479
124	G	A	-1.4603
125	G	A	-1.3538
126	G	A	-1.3632
127	S	A	-1.5755
128	H	A	-2.1370
129	H	A	-2.5102
130	H	A	-2.7265
131	H	A	-2.4802
132	H	A	-2.2385
133	H	A	-1.4673
134	L	A	0.0586
135	E	A	-0.6884
136	Y	A	0.7231
137	P	A	0.3880
138	Y	A	0.8018
139	D	A	-0.5920
140	V	A	0.7976
141	P	A	-0.1879
142	D	A	-1.0148
143	Y	A	0.5914
144	A	A	0.2389