Project name: query_structure

Status: done

Started: 2026-03-17 00:06:27
Settings
Chain sequence(s) A: MAVSDVPRKLEVVAATPTSLLISWDYSYYYYYYYRITYGETGGNSPVQEFTVPYGSYTATISGLKPGVDYTITVYAVTYSGSVHYISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:54)
Show buried residues

Minimal score value
-2.7896
Maximal score value
2.821
Average score
-0.1297
Total score value
-11.9353

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.4282
2 A A 1.0372
3 V A 1.4512
4 S A 0.2928
5 D A 0.4335
6 V A 0.6002
7 P A 0.0000
8 R A -2.0126
9 K A -2.7896
10 L A 0.0000
11 E A -1.9552
12 V A 0.1174
13 V A 1.5549
14 A A 0.9162
15 A A 0.3493
16 T A -0.3321
17 P A -1.1086
18 T A -0.9945
19 S A -0.5133
20 L A 0.0000
21 L A 0.7921
22 I A 0.0000
23 S A -0.6117
24 W A 0.0000
25 D A -1.9385
26 Y A 0.1212
27 S A 0.0000
28 Y A 2.0899
29 Y A 2.5648
30 Y A 2.8210
31 Y A 0.0000
32 Y A 2.3632
33 Y A 1.4202
34 Y A 0.0000
35 R A -0.2196
36 I A 0.0000
37 T A 0.0000
38 Y A -0.4972
39 G A -0.8501
40 E A -1.7504
41 T A -1.3371
42 G A -1.2753
43 G A -1.4840
44 N A -1.5974
45 S A -0.9729
46 P A -0.4963
47 V A 0.0906
48 Q A -1.2964
49 E A -1.8730
50 F A -0.7151
51 T A -0.1832
52 V A 0.4248
53 P A 0.4649
54 Y A 1.2901
55 G A 0.5734
56 S A 0.1510
57 Y A 0.1165
58 T A 0.0165
59 A A 0.0000
60 T A 0.3107
61 I A 0.0000
62 S A -0.6402
63 G A -1.0256
64 L A 0.0000
65 K A -2.3849
66 P A -1.6577
67 G A -1.4587
68 V A -1.4660
69 D A -2.1455
70 Y A 0.0000
71 T A -0.8163
72 I A 0.0000
73 T A 0.0000
74 V A 0.0000
75 Y A 0.9693
76 A A 0.0000
77 V A 0.0000
78 T A 1.7702
79 Y A 1.8948
80 S A 0.4945
81 G A 0.2718
82 S A 0.5807
83 V A 1.4063
84 H A 1.0673
85 Y A 1.6237
86 I A 0.6886
87 S A -0.1615
88 I A -0.6694
89 N A -1.7268
90 Y A -1.4832
91 R A -2.5481
92 T A -1.5063
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018