Project name: query_structure

Status: done

Started: 2026-03-16 23:52:18
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSKSNIRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVYRTGGYRHRYLKLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-3.5877
Maximal score value
2.0124
Average score
-0.8877
Total score value
-91.4316

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.4611
2 Q A -0.8028
3 V A -0.8129
4 D A -0.6509
5 I A 0.0000
6 V A 0.9832
7 P A 0.0838
8 S A -0.6629
9 Q A -1.9609
10 G A 0.0000
11 E A -2.7898
12 I A 0.0000
13 S A -1.0444
14 V A -0.1043
15 G A -1.2055
16 E A -2.1547
17 S A -0.8959
18 K A -0.3006
19 F A 2.0124
20 F A 0.0000
21 L A 1.0151
22 C A 0.0000
23 Q A -1.1531
24 V A 0.0000
25 A A -0.6682
26 G A -0.9369
27 S A -1.4938
28 K A -2.6490
29 S A -2.3024
30 N A -2.5401
31 I A -1.9813
32 R A -1.6924
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.4342
37 S A -1.4010
38 P A -1.3538
39 N A -2.1011
40 G A -2.2611
41 E A -3.2413
42 K A -2.7957
43 L A -1.6015
44 T A -1.0921
45 P A -0.8062
46 N A -1.9994
47 Q A -2.0952
48 Q A -2.1134
49 R A -1.4158
50 I A 0.0000
51 S A -0.1931
52 V A 0.0000
53 V A 0.7473
54 W A -0.5637
55 N A -1.8742
56 D A -3.0270
57 D A -3.5877
58 S A -2.4820
59 S A -1.5095
60 S A 0.0000
61 T A 0.7466
62 L A 0.0000
63 T A 0.9453
64 I A 0.0000
65 Y A -0.4526
66 N A -1.8150
67 A A 0.0000
68 N A -0.9024
69 I A 0.0436
70 D A -1.5192
71 D A 0.0000
72 A A -0.8755
73 G A -0.5209
74 I A 0.1134
75 Y A 0.0000
76 K A -1.1337
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 Y A -0.8791
81 R A -1.7376
82 T A -1.4972
83 G A -1.1290
84 G A -1.0481
85 Y A -0.3713
86 R A -2.3581
87 H A -2.2720
88 R A -2.3469
89 Y A -0.5862
90 L A 0.3157
91 K A -1.0371
92 L A -0.0828
93 G A -0.6750
94 E A -1.5209
95 A A -1.1425
96 T A -0.5865
97 V A 0.0000
98 N A -1.6423
99 V A 0.0000
100 K A -2.3397
101 I A 0.0000
102 F A -0.2820
103 Q A -0.3937
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018