Project name: query_structure

Status: done

Started: 2026-03-16 23:47:10
Settings
Chain sequence(s) A: GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:21)
Show buried residues

Minimal score value
-1.8834
Maximal score value
2.8902
Average score
0.3439
Total score value
10.6608

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.8780
2 T A 0.1413
3 F A 1.2651
4 P A 0.3334
5 C A 0.4327
6 G A -0.0777
7 E A 0.1180
8 S A 0.5808
9 C A 1.1796
10 V A 2.4893
11 F A 2.8902
12 I A 2.1662
13 P A 1.2337
14 C A 0.0000
15 L A 1.7036
16 T A 1.1395
17 S A 0.7963
18 A A 1.1556
19 I A 1.8943
20 G A 0.1999
21 C A 0.0000
22 S A -0.5771
23 C A -0.3703
24 K A -1.8834
25 S A -1.1981
26 K A -0.9156
27 V A -0.4873
28 C A 0.0000
29 Y A -0.5614
30 K A -0.6535
31 N A -1.4563
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018