Project name: cf8690f3c5d82bb

Status: done

Started: 2026-03-19 12:13:29
Settings
Chain sequence(s) A: MNLTKILPTFAAVVVLSACAKDAPEMTKSSAQIAEMQTLPTITDKTVVYSCNKQTVTAVYQFENQEPVAAMVSVGDGIIAKDFTRDKSQNDFTSFVSGDYVWNVDSGLTLDKFDSVVPVNLIQKGKSSDNIIVKNCDVNVKATKKANL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)
Show buried residues

Minimal score value
-3.0426
Maximal score value
3.9049
Average score
-0.6382
Total score value
-94.4583

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7641
2 N A -0.2375
3 L A 0.9215
4 T A 0.0550
5 K A -0.1571
6 I A 1.9946
7 L A 2.1954
8 P A 1.4555
9 T A 1.4145
10 F A 2.2508
11 A A 1.5846
12 A A 2.0432
13 V A 3.5459
14 V A 3.9049
15 V A 3.8361
16 L A 2.9906
17 S A 1.3867
18 A A 0.8700
19 C A 0.4060
20 A A -0.7713
21 K A -2.4759
22 D A -2.9319
23 A A -1.6860
24 P A -1.6732
25 E A -1.9202
26 M A -0.5472
27 T A -1.0492
28 K A -1.7625
29 S A -0.9534
30 S A -0.5238
31 A A -0.6279
32 Q A -0.9037
33 I A 0.7684
34 A A -0.1131
35 E A -1.3240
36 M A 0.1177
37 Q A -0.6672
38 T A 0.0747
39 L A 1.3112
40 P A 0.3415
41 T A 0.3382
42 I A 0.7377
43 T A -0.8162
44 D A -1.7616
45 K A -1.7379
46 T A -1.1152
47 V A 0.0000
48 V A -0.6720
49 Y A 0.0000
50 S A -1.7678
51 C A 0.0000
52 N A -3.0426
53 K A -2.8252
54 Q A -2.2069
55 T A -1.4906
56 V A 0.0000
57 T A 0.0254
58 A A 0.0000
59 V A -0.4011
60 Y A 0.0000
61 Q A -1.1284
62 F A 0.0000
63 E A -1.2253
64 N A -1.5975
65 Q A -2.5738
66 E A -2.3173
67 P A 0.0000
68 V A -0.5395
69 A A -0.9673
70 A A 0.0000
71 M A -0.6337
72 V A 0.0000
73 S A 0.0000
74 V A 0.0067
75 G A -1.1327
76 D A -1.6428
77 G A -0.2480
78 I A 0.9902
79 I A 0.4824
80 A A -0.5174
81 K A -2.0322
82 D A -2.5011
83 F A 0.0000
84 T A -0.9084
85 R A -1.1395
86 D A -1.5504
87 K A -2.4298
88 S A -1.9277
89 Q A -2.1958
90 N A -2.6700
91 D A -2.5590
92 F A -1.5431
93 T A 0.0000
94 S A 0.0000
95 F A 0.0000
96 V A -0.0245
97 S A -0.9279
98 G A -1.2150
99 D A -1.8123
100 Y A -0.5504
101 V A 0.0907
102 W A 0.0000
103 N A 0.0000
104 V A 0.0000
105 D A -1.0483
106 S A -1.2390
107 G A -1.3872
108 L A 0.0000
109 T A -2.0607
110 L A -2.4183
111 D A -2.8832
112 K A -2.4192
113 F A -1.4413
114 D A -1.5145
115 S A -1.1864
116 V A 0.0000
117 V A -0.4307
118 P A 0.0000
119 V A -0.0032
120 N A 0.3014
121 L A 0.0000
122 I A -0.0208
123 Q A -1.3214
124 K A -2.9082
125 G A -2.8880
126 K A -2.4973
127 S A -1.7959
128 S A -1.9084
129 D A -2.5601
130 N A -1.2251
131 I A 1.0351
132 I A 0.9988
133 V A 0.0000
134 K A -1.1564
135 N A -2.3350
136 C A -2.0159
137 D A -1.8825
138 V A -0.6890
139 N A -0.9894
140 V A -0.4446
141 K A -1.9721
142 A A -1.5917
143 T A 0.0000
144 K A -2.6242
145 K A -2.3260
146 A A -1.1471
147 N A -1.0863
148 L A 0.3926
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018