Project name: cfd962e513f0e8a

Status: done

Started: 2026-06-22 09:06:53
Settings
Chain sequence(s) I: MENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSSTSPKLWIYDTSKLASGVPGRFSGSGSGNSYSLTISSMEAEDVATYYCFQGSGYPLTFGAGTKLELKGGGGSGGGGSGGGGSEVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARKKSYAMDYWGQGTSVTVS
input PDB
Selected Chain(s) I
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with I chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:59)
Show buried residues

Minimal score value
-2.3137
Maximal score value
1.8246
Average score
-0.2412
Total score value
-57.417

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M I 0.7209
2 E I -1.6500
3 N I -0.1355
4 V I 1.7505
5 L I 0.0000
6 T I -0.0709
7 Q I 0.0000
8 S I -0.1706
9 P I -0.1531
10 A I 0.3856
11 I I 1.8246
12 M I 0.4663
13 S I -0.1854
14 A I 0.0000
15 S I -0.2752
16 P I -0.2316
17 G I -0.7695
18 E I -1.7566
19 K I -1.9243
20 V I -0.1244
21 T I -0.0108
22 M I 0.0000
23 T I -0.0391
24 C I 0.0000
25 S I -0.0976
26 A I 0.0000
27 S I -0.2352
28 S I -0.1990
29 S I -0.2063
30 V I 0.1906
31 S I 0.0892
32 Y I 0.5442
33 M I 0.0000
34 H I 0.0000
35 W I 0.0000
36 Y I 0.0000
37 Q I 0.0000
38 Q I 0.0000
39 K I -1.0074
40 S I -0.4282
41 S I -0.2565
42 T I -0.0751
43 S I -0.0373
44 P I 0.0000
45 K I -0.3277
46 L I 0.0000
47 W I 0.0000
48 I I 0.0000
49 Y I 0.4078
50 D I -0.3633
51 T I -0.1292
52 S I -0.4885
53 K I -1.4366
54 L I 0.3444
55 A I 0.0000
56 S I -0.2971
57 G I -0.5279
58 V I 0.0000
59 P I -0.1281
60 G I -0.5240
61 R I -0.3591
62 F I 0.0000
63 S I -0.1541
64 G I 0.0000
65 S I -0.2528
66 G I -0.2952
67 S I -0.2759
68 G I -0.3463
69 N I -0.9403
70 S I -0.3792
71 Y I 0.0000
72 S I -0.0464
73 L I 0.0000
74 T I -0.0194
75 I I 0.0000
76 S I -0.3345
77 S I -0.2737
78 M I 0.0000
79 E I -0.2060
80 A I -0.3503
81 E I -1.8141
82 D I 0.0000
83 V I 0.6536
84 A I 0.0000
85 T I -0.1381
86 Y I 0.0000
87 Y I 0.0000
88 C I 0.0000
89 F I 0.0000
90 Q I 0.0000
91 G I 0.0000
92 S I -0.1465
93 G I -0.0966
94 Y I 0.9516
95 P I 0.2392
96 L I 0.0000
97 T I -0.0102
98 F I 0.0000
99 G I 0.0000
100 A I 0.0585
101 G I 0.0000
102 T I 0.0000
103 K I -0.7167
104 L I 0.0000
105 E I -1.2119
106 L I 0.0000
107 K I -1.7934
108 G I -0.7795
109 G I 0.0000
110 G I -0.5543
111 G I -0.5934
112 S I -0.3829
113 G I -0.5885
114 G I -0.6028
115 G I -0.4582
116 G I -0.5444
117 S I -0.4343
118 G I -0.5929
119 G I -0.6382
120 G I -0.6359
121 G I -0.5902
122 S I -0.5470
123 E I -1.3506
124 V I -0.1573
125 Q I -0.5798
126 L I 0.0000
127 Q I -0.9001
128 Q I -0.2790
129 S I -0.2326
130 G I -0.4785
131 A I -0.2038
132 E I -0.6006
133 L I 1.4156
134 V I 0.1271
135 R I -1.8275
136 A I -0.3904
137 G I -0.5019
138 S I -0.1691
139 S I -0.2986
140 V I 0.0000
141 K I -1.7484
142 M I 0.0000
143 S I -0.0186
144 C I 0.0000
145 K I -1.3193
146 A I 0.0000
147 S I -0.2261
148 G I -0.4213
149 Y I 0.1013
150 T I -0.0345
151 F I 0.0000
152 T I -0.1145
153 S I -0.1775
154 Y I -0.0582
155 G I 0.0000
156 I I 0.0000
157 N I 0.0000
158 W I 0.0000
159 V I 0.0000
160 K I 0.0000
161 Q I -0.2456
162 R I -0.4969
163 P I -0.4147
164 G I -0.6130
165 Q I -0.6481
166 G I -0.1770
167 L I 0.0000
168 E I -0.4481
169 W I 0.0000
170 I I 0.0000
171 G I 0.0000
172 Y I 0.1529
173 I I 0.0000
174 N I -0.4067
175 P I 0.0000
176 G I -0.6117
177 N I -1.3984
178 G I -0.4071
179 Y I 0.6989
180 T I 0.0197
181 K I -0.4687
182 Y I 0.1537
183 N I 0.0000
184 E I -2.3137
185 K I -2.0372
186 F I 0.0000
187 K I -1.9747
188 G I -0.8440
189 K I -0.4961
190 T I 0.0000
191 T I -0.0282
192 L I 0.0000
193 T I 0.0329
194 V I 0.2139
195 D I -0.9136
196 K I -1.8646
197 S I -0.5323
198 S I -0.1252
199 S I -0.2315
200 T I 0.0000
201 A I 0.0000
202 Y I 0.2668
203 M I 0.0000
204 Q I -0.6117
205 L I 0.0000
206 R I -1.4440
207 S I -0.5331
208 L I 0.0000
209 T I -0.0566
210 S I -0.5412
211 E I -1.8579
212 D I 0.0000
213 S I -0.0501
214 A I 0.0000
215 V I 0.4632
216 Y I 0.0000
217 F I 0.0000
218 C I 0.0000
219 A I 0.0000
220 R I 0.0000
221 K I 0.0000
222 K I -1.6828
223 S I -0.2267
224 Y I 0.8898
225 A I 0.0000
226 M I 0.0000
227 D I -0.3279
228 Y I 0.5053
229 W I 0.2236
230 G I 0.0000
231 Q I -1.0851
232 G I -0.2554
233 T I 0.0000
234 S I -0.0295
235 V I 0.0000
236 T I -0.0585
237 V I 0.0000
238 S I -0.3977
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018