Project name: obj1 [mutate: GR113C, TA114C, LD115C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LD115C,TA114C,GR113C
Energy difference between WT (input) and mutated protein (by FoldX)	11.1435 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)

• Minimal score value: -3.3326
• Maximal score value: 1.5458
• Average score: -0.8081
• Total score value: -96.9693

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9163
3	Q	C	-1.2800
4	L	C	0.0000
5	V	C	0.3037
6	E	C	0.0000
7	S	C	-0.9377
8	G	C	-1.3636
9	G	C	-1.1379
10	G	C	-0.0034
11	L	C	0.9666
12	V	C	-0.0546
13	Q	C	-1.3453
14	P	C	-1.4924
15	G	C	-1.4163
16	G	C	-0.9838
17	S	C	-1.2346
18	L	C	-0.9917
19	R	C	-2.1805
20	L	C	0.0000
21	S	C	-0.5386
22	C	C	0.0000
23	A	C	-0.2075
24	A	C	0.0000
25	S	C	-0.2226
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1451
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.9185
40	A	C	-1.3843
41	P	C	-1.3168
42	G	C	-1.4423
43	K	C	-2.1552
44	G	C	-1.1108
45	L	C	0.2545
46	E	C	-0.4440
47	W	C	0.3134
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6492
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6605
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4751
88	A	C	-1.8924
89	E	C	-2.3461
90	D	C	0.0000
91	T	C	-1.0219
92	A	C	0.0000
93	I	C	-0.8434
94	Y	C	0.0000
95	Y	C	-0.2871
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1893
101	D	C	-3.3326
102	G	C	-2.0861
103	F	C	-1.2304
104	N	C	-2.4279
105	K	C	-3.1836
106	G	C	-1.9050
107	F	C	-0.9816
108	D	C	-1.0969
109	Y	C	-0.2081
110	W	C	0.3823
111	G	C	-0.4204
112	Q	C	-1.4132
113	R	C	-1.7240	mutated: GR113C
114	A	C	-1.5401	mutated: TA114C
115	D	C	-1.7973	mutated: LD115C
116	V	C	0.0000
117	T	C	-0.4830
118	V	C	0.0000
119	S	C	-0.7717
120	S	C	-1.0586