Project name: Design58_0_10mutated

Status: done

Started: 2026-07-20 20:42:50
Settings
Chain sequence(s) B: SIELKYKFKGTTGLIGIINHPELSSFVIDGFGNKVKVFVNAKSGIGKIELEVRTPSLEEPVRAQSQITIKNGQKTVKVQAQAQVGDLESDEVEVTITLYPG
input PDB
Selected Chain(s) B
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:02)
Show buried residues

Minimal score value
-2.1537
Maximal score value
2.0908
Average score
-0.4407
Total score value
-44.5064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.0085
2 I B 0.4778
3 E B -1.6361
4 L B -0.4953
5 K B -1.6281
6 Y B -0.3766
7 K B -1.7335
8 F B -0.2531
9 K B -1.8064
10 G B 0.0000
11 T B -0.0564
12 T B -0.1038
13 G B 0.1328
14 L B 1.5425
15 I B 0.5203
16 G B 0.3547
17 I B 2.0908
18 I B 0.4276
19 N B -1.2391
20 H B -0.3987
21 P B -0.4036
22 E B -0.7277
23 L B 0.0000
24 S B -0.2335
25 S B -0.1997
26 F B 0.0000
27 V B 0.5418
28 I B 0.0000
29 D B -0.0856
30 G B 0.0000
31 F B 1.2744
32 G B -0.4368
33 N B -1.4739
34 K B -1.0416
35 V B 0.0000
36 K B -0.4989
37 V B 0.0000
38 F B 0.3121
39 V B 0.0000
40 N B -0.4954
41 A B -0.2823
42 K B -1.2059
43 S B -0.5078
44 G B -0.5039
45 I B 0.0000
46 G B -0.3135
47 K B -0.6672
48 I B 0.0000
49 E B -0.7941
50 L B 0.0000
51 E B -0.8230
52 V B 0.0000
53 R B -1.9859
54 T B 0.0000
55 P B -0.2828
56 S B -0.1527
57 L B -0.0892
58 E B -2.1019
59 E B -2.1537
60 P B -0.5208
61 V B 0.0405
62 R B -1.8448
63 A B -0.5509
64 Q B -1.2790
65 S B -0.4754
66 Q B -1.0226
67 I B 0.7531
68 T B 0.5115
69 I B 1.4842
70 K B -1.5495
71 N B -1.6548
72 G B -0.9051
73 Q B -1.5914
74 K B -1.6789
75 T B -0.3345
76 V B 0.0000
77 K B -0.7656
78 V B 0.0000
79 Q B -1.1459
80 A B 0.0000
81 Q B -1.0809
82 A B 0.0000
83 Q B -1.2877
84 V B 0.0000
85 G B -0.6933
86 D B -1.8205
87 L B 0.0000
88 E B -1.8592
89 S B -0.5892
90 D B -0.5657
91 E B -1.9292
92 V B 0.0000
93 E B -1.6675
94 V B 0.0000
95 T B -0.2750
96 I B 0.0000
97 T B -0.3095
98 L B 0.0000
99 Y B 0.3947
100 P B -0.2450
101 G B -0.5271
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018