Project name: PLO_Nb1

Chain sequence(s)	A: QVQLVESGGALVQPGGSLRLTCKPLGANFDTYAVAWFRQAPGKERVGSCLNKGDEDKYYSDAVKGRFTISWNDAKNMVFLEMTDLMADDTGVYYCAGGWFAPLIAAVTYGSPFEYANWGQGTQVTVS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)

• Minimal score value: -3.1946
• Maximal score value: 2.5513
• Average score: -0.5899
• Total score value: -74.9166

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.2306
2	V	A	-1.0084
3	Q	A	-0.9120
4	L	A	0.0000
5	V	A	-0.0954
6	E	A	-0.6867
7	S	A	-0.8798
8	G	A	-0.9955
9	G	A	-0.6547
10	A	A	0.0625
11	L	A	1.0305
12	V	A	0.0000
13	Q	A	-1.2792
14	P	A	-1.2634
15	G	A	-1.5497
16	G	A	-1.0476
17	S	A	-1.4185
18	L	A	-1.1014
19	R	A	-2.0519
20	L	A	0.0000
21	T	A	-0.8031
22	C	A	0.0000
23	K	A	-1.1234
24	P	A	-0.7838
25	L	A	0.0669
26	G	A	-0.5695
27	A	A	-1.1683
28	N	A	-2.2601
29	F	A	0.0000
30	D	A	-2.1049
31	T	A	0.0000
32	Y	A	1.3350
33	A	A	0.0000
34	V	A	0.0000
35	A	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-1.4483
40	A	A	0.0000
41	P	A	-1.2857
42	G	A	-1.7363
43	K	A	-2.9326
44	E	A	-2.7747
45	R	A	-1.6423
46	V	A	0.0000
47	G	A	0.0000
48	S	A	0.0000
49	C	A	0.0000
50	L	A	0.0000
51	N	A	-1.2792
52	K	A	-2.0477
53	G	A	-2.2087
54	D	A	-2.6766
55	E	A	-3.1946
56	D	A	-2.4069
57	K	A	-1.3683
58	Y	A	0.1791
59	Y	A	-0.4203
60	S	A	0.0000
61	D	A	-2.3304
62	A	A	-1.6034
63	V	A	0.0000
64	K	A	-2.5050
65	G	A	-1.8689
66	R	A	-1.9164
67	F	A	0.0000
68	T	A	-1.0568
69	I	A	0.0000
70	S	A	-0.9281
71	W	A	-1.3009
72	N	A	-1.9838
73	D	A	-3.0299
74	A	A	-1.7706
75	K	A	-2.6752
76	N	A	-2.4039
77	M	A	-1.4708
78	V	A	0.0000
79	F	A	0.0000
80	L	A	0.0000
81	E	A	-1.8630
82	M	A	0.0000
83	T	A	-1.6194
84	D	A	-2.1235
85	L	A	0.0000
86	M	A	-0.7619
87	A	A	-0.8316
88	D	A	-1.7479
89	D	A	0.0000
90	T	A	-0.5533
91	G	A	-0.8493
92	V	A	-0.4365
93	Y	A	0.0000
94	Y	A	-0.0557
95	C	A	0.0000
96	A	A	0.0000
97	G	A	0.0000
98	G	A	0.0000
99	W	A	1.8484
100	F	A	2.5513
101	A	A	0.0000
102	P	A	1.1037
103	L	A	0.0000
104	I	A	2.1866
105	A	A	1.3886
106	A	A	0.0000
107	V	A	1.0351
108	T	A	0.7133
109	Y	A	1.2698
110	G	A	0.6817
111	S	A	0.6733
112	P	A	0.6957
113	F	A	1.6655
114	E	A	1.0000
115	Y	A	0.0000
116	A	A	0.5534
117	N	A	0.0000
118	W	A	0.0978
119	G	A	-0.5424
120	Q	A	-1.2108
121	G	A	-0.7018
122	T	A	-0.8159
123	Q	A	-1.1040
124	V	A	0.0000
125	T	A	-0.1003
126	V	A	0.0000
127	S	A	-0.4833