Project name: d04aad93be9886c

Status: done

Started: 2026-04-20 09:08:24
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASAYYVKWFRQAPGKGRELVASPASPGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAASPDSSGTVYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)
Show buried residues

Minimal score value
-3.1253
Maximal score value
1.6534
Average score
-0.7783
Total score value
-79.3827

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9293
2 V A -0.8230
3 Q A -1.2536
4 L A 0.0000
5 V A -0.0091
6 E A 0.0000
7 S A -0.8113
8 G A -0.9607
9 G A -0.7883
10 G A -0.0639
11 L A 0.9998
12 V A -0.0777
13 Q A -1.3525
14 P A -1.7007
15 G A -1.5241
16 G A -1.1812
17 S A -1.4306
18 L A -1.0347
19 R A -2.1113
20 L A 0.0000
21 S A -0.5211
22 C A 0.0000
23 A A -0.8754
24 A A 0.0000
25 S A -0.8909
26 A A 0.0000
27 Y A 1.3743
28 Y A 1.6534
29 V A 0.0000
30 K A -0.0304
31 W A 0.0000
32 F A -0.1114
33 R A -1.0944
34 Q A -2.0309
35 A A -1.9027
36 P A -1.3362
37 G A -1.7785
38 K A -2.9419
39 G A -2.5981
40 R A -2.7320
41 E A -1.7997
42 L A 0.1891
43 V A -0.0120
44 A A 0.0000
45 S A 0.0000
46 P A -0.2698
47 A A -0.2891
48 S A -0.3978
49 P A -0.7642
50 G A -1.1818
51 R A -1.5392
52 F A 0.0000
53 T A -0.8677
54 I A -0.4908
55 S A -0.5806
56 R A -1.1765
57 D A -2.2367
58 N A -2.5889
59 A A -2.1114
60 K A -3.1253
61 R A -3.0487
62 M A -1.6590
63 V A 0.0000
64 Y A -0.5834
65 L A 0.0000
66 Q A -1.4342
67 M A 0.0000
68 N A -1.7752
69 S A -1.4783
70 L A 0.0000
71 R A -2.7550
72 A A -1.9506
73 E A -2.3893
74 D A 0.0000
75 T A -0.9906
76 A A 0.0000
77 V A -0.6179
78 Y A 0.0000
79 Y A -0.2970
80 C A 0.0000
81 A A 0.0000
82 A A 0.0000
83 S A -0.0065
84 P A -0.4514
85 D A -2.0757
86 S A -1.4123
87 S A -1.0335
88 G A -0.8394
89 T A -0.1778
90 V A 0.9167
91 Y A 0.7506
92 W A 0.5127
93 G A -0.2950
94 Q A -0.9402
95 G A -0.6861
96 T A -0.8580
97 Q A -1.0506
98 V A 0.0000
99 T A -0.3531
100 V A 0.0000
101 S A -0.7920
102 S A -0.5011
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018