Project name: obj1 [mutate: SC7C, AD23C, NL77C, LK81C, SV85C, ST119C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	AD23C,SV85C,LK81C,NL77C,ST119C,SC7C
Energy difference between WT (input) and mutated protein (by FoldX)	6.39412 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:38)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -3.333
• Maximal score value: 1.8238
• Average score: -0.6104
• Total score value: -73.2531

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9168
3	Q	C	-1.6551
4	L	C	0.0000
5	V	C	-0.3351
6	E	C	0.0000
7	C	C	-0.2284	mutated: SC7C
8	G	C	-0.6124
9	G	C	0.0993
10	G	C	0.9130
11	L	C	1.4288
12	V	C	-0.0245
13	Q	C	-1.0923
14	P	C	-1.0066
15	G	C	-0.5493
16	G	C	-0.3968
17	S	C	-0.7209
18	L	C	-0.7607
19	R	C	-2.0847
20	L	C	0.0000
21	S	C	-0.8061
22	C	C	0.0000
23	D	C	-1.8641	mutated: AD23C
24	A	C	0.0000
25	S	C	-0.5288
26	D	C	0.0000
27	F	C	1.6591
28	T	C	0.3524
29	F	C	0.0000
30	R	C	-1.8732
31	S	C	-0.8784
32	Y	C	-1.2148
33	E	C	-1.1446
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2969
40	A	C	-0.9853
41	P	C	-1.2938
42	G	C	-1.4348
43	K	C	-2.1351
44	G	C	-1.0592
45	L	C	0.3943
46	E	C	-0.3920
47	W	C	0.3381
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5822
53	G	C	-1.2341
54	S	C	-1.2157
55	G	C	-1.0731
56	G	C	-0.7345
57	S	C	-0.3016
58	T	C	0.2005
59	Y	C	0.6114
60	Y	C	-0.3563
61	A	C	-1.1395
62	D	C	-2.3451
63	S	C	-1.7170
64	V	C	0.0000
65	K	C	-2.3851
66	G	C	-1.3914
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6633
70	I	C	0.0000
71	S	C	-0.5551
72	R	C	-1.2124
73	D	C	-1.7370
74	N	C	-1.8249
75	S	C	-1.5287
76	K	C	-2.2152
77	L	C	-1.3197	mutated: NL77C
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.8134
81	K	C	0.0000	mutated: LK81C
82	Q	C	-1.2188
83	M	C	0.0000
84	N	C	-0.3712
85	V	C	0.6627	mutated: SV85C
86	L	C	0.0000
87	R	C	-1.8512
88	A	C	-1.7863
89	E	C	-2.2840
90	D	C	0.0000
91	T	C	-0.3871
92	A	C	0.0000
93	I	C	1.0713
94	Y	C	0.0000
95	Y	C	0.6206
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1904
101	D	C	-3.3330
102	G	C	-2.0864
103	F	C	-1.2304
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.0994
109	Y	C	-0.2104
110	W	C	0.5120
111	G	C	-0.4090
112	Q	C	-0.9030
113	G	C	0.1528
114	T	C	0.6825
115	L	C	1.8238
116	V	C	0.0000
117	T	C	0.3574
118	V	C	0.0000
119	T	C	-0.6439	mutated: ST119C
120	S	C	-0.9794