Project name: d15784b8928fd37

Status: done

Started: 2026-06-22 16:05:13
Settings
Chain sequence(s) B: AELAALRAQLKGAAEAYKLMLEVAKQLGLDTEKIEKKTKERIERIKKIIE
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:38)
Show buried residues

Minimal score value
-5.7188
Maximal score value
0.7231
Average score
-1.9242
Total score value
-96.2077

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.2652
2 E B -0.8706
3 L B 0.7231
4 A B 0.1632
5 A B -0.3334
6 L B 0.0167
7 R B -0.9719
8 A B -1.1527
9 Q B -1.6586
10 L B -1.5115
11 K B -2.6840
12 G B -2.1043
13 A B -1.6270
14 A B -2.5839
15 E B -2.2014
16 A B -0.7963
17 Y B -1.1233
18 K B -1.3514
19 L B 0.1947
20 M B 0.3843
21 L B 0.0000
22 E B -1.8016
23 V B -0.0393
24 A B 0.0000
25 K B -2.3360
26 Q B -1.3258
27 L B 0.2543
28 G B -0.6825
29 L B -0.2441
30 D B -2.3687
31 T B -2.9439
32 E B -4.0635
33 K B -4.0944
34 I B -2.9397
35 E B -4.7582
36 K B -5.1142
37 K B -4.9991
38 T B 0.0000
39 K B -5.3399
40 E B -5.7188
41 R B -5.3575
42 I B 0.0000
43 E B -4.9820
44 R B -4.3351
45 I B -3.0759
46 K B -3.7224
47 K B -3.0237
48 I B -0.3782
49 I B -1.0080
50 E B -2.0560
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018