Project name: query_structure

Status: done

Started: 2026-03-17 01:20:51
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYHITYGETGWYSGYQEFTVPGSKSTATISGLKPGVDYTITVYAAYMYYSQYEWSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:12)
Show buried residues

Minimal score value
-2.6787
Maximal score value
1.8131
Average score
-0.3134
Total score value
-29.4604

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8131
2 S A 0.8376
3 S A 0.7335
4 V A 0.6387
5 P A 0.0000
6 T A -1.6431
7 K A -2.6787
8 L A 0.0000
9 E A -1.9146
10 V A 0.1265
11 V A 1.5502
12 A A 0.9031
13 A A 0.3147
14 T A -0.3398
15 P A -1.1227
16 T A -0.9986
17 S A -0.5278
18 L A 0.0000
19 L A 0.7598
20 I A 0.0000
21 S A -0.9653
22 W A 0.0000
23 D A -2.6560
24 A A -1.2197
25 P A 0.0623
26 A A 0.4957
27 V A 0.7500
28 T A 0.0518
29 V A -0.1568
30 D A -0.9809
31 F A -0.4546
32 Y A 0.0000
33 H A -0.0997
34 I A 0.0000
35 T A -0.7937
36 Y A -0.6801
37 G A 0.0000
38 E A -0.8135
39 T A -0.4312
40 G A 0.1867
41 W A 1.3477
42 Y A 1.5859
43 S A 0.4774
44 G A -0.1850
45 Y A -0.1912
46 Q A -1.5200
47 E A -1.8956
48 F A -0.5813
49 T A -0.1374
50 V A 0.0000
51 P A -0.9509
52 G A -1.1034
53 S A -1.2594
54 K A -2.0915
55 S A -1.3524
56 T A -0.7432
57 A A 0.0000
58 T A 0.2410
59 I A 0.0000
60 S A -0.6609
61 G A -1.0288
62 L A 0.0000
63 K A -2.3639
64 P A -1.6646
65 G A -1.4691
66 V A -1.4326
67 D A -2.0307
68 Y A 0.0000
69 T A -0.7211
70 I A 0.0000
71 T A -0.2398
72 V A 0.0000
73 Y A 0.5138
74 A A 0.0000
75 A A 0.0000
76 Y A 0.6060
77 M A 1.2174
78 Y A 1.5726
79 Y A 1.4829
80 S A 0.4122
81 Q A -0.0109
82 Y A 0.7980
83 E A 0.3968
84 W A 1.0092
85 S A 0.0000
86 S A 0.0780
87 P A 0.1772
88 I A 0.0838
89 S A -0.5394
90 I A -0.7161
91 N A -1.7352
92 Y A -1.5099
93 R A -2.5476
94 T A -1.5253
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018