Project name: G2G2

Chain sequence(s)	H: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSQMGWFRQAPGKEREFVSAVTLVSRTHYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCVARAAWGTDYREQGYWGQGTQVTVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)

• Minimal score value: -2.886
• Maximal score value: 1.4249
• Average score: -0.7329
• Total score value: -88.6796

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	H	-1.9567
2	V	H	-1.0053
3	Q	H	-1.1265
4	L	H	0.0000
5	L	H	0.3222
6	E	H	-0.3426
7	S	H	-0.8553
8	G	H	-1.2457
9	G	H	-0.7264
11	G	H	0.1905
12	L	H	1.1287
13	V	H	0.0170
14	Q	H	-1.2990
15	P	H	-1.6756
16	G	H	-1.2645
17	G	H	-1.0379
18	S	H	-1.1816
19	L	H	-0.9357
20	R	H	-2.1471
21	L	H	0.0000
22	S	H	-0.6165
23	C	H	0.0000
24	A	H	-0.3881
25	A	H	0.0000
26	S	H	-0.8211
27	G	H	-1.0539
28	F	H	-0.3672
29	T	H	-0.2627
30	F	H	0.0000
35	S	H	-0.1803
36	S	H	0.1316
37	S	H	0.0000
38	Q	H	-0.0384
39	M	H	0.0000
40	G	H	0.0000
41	W	H	0.0000
42	F	H	0.0000
43	R	H	0.0000
44	Q	H	-1.3986
45	A	H	-1.4605
46	P	H	-1.1249
47	G	H	-1.5514
48	K	H	-2.4289
49	E	H	-2.8860
50	R	H	-1.9722
51	E	H	-1.2809
52	F	H	-0.1128
53	V	H	0.0000
54	S	H	0.0000
55	A	H	-0.4541
56	V	H	0.0000
57	T	H	0.0028
58	L	H	0.9900
59	V	H	1.4249
63	S	H	-0.2969
64	R	H	-1.4492
65	T	H	-1.0001
66	H	H	-1.4340
67	Y	H	-1.0768
68	A	H	-1.3549
69	D	H	-2.5356
70	S	H	-1.7226
71	V	H	0.0000
72	K	H	-2.7560
74	G	H	-1.7794
75	R	H	-1.6066
76	F	H	0.0000
77	T	H	-0.9878
78	I	H	0.0000
79	S	H	-0.7045
80	R	H	-0.7277
81	D	H	-1.5573
82	N	H	-1.8203
83	A	H	-1.4980
84	K	H	-2.3098
85	N	H	-1.8047
86	T	H	-1.1422
87	L	H	0.0000
88	Y	H	-0.6719
89	L	H	0.0000
90	Q	H	-1.3398
91	M	H	0.0000
92	N	H	-1.3431
93	S	H	-1.1497
94	L	H	0.0000
95	R	H	-2.1583
96	A	H	-1.6362
97	E	H	-2.2204
98	D	H	0.0000
99	T	H	-0.7474
100	A	H	0.0000
101	M	H	-0.3065
102	Y	H	0.0000
103	Y	H	-0.0011
104	C	H	0.0000
105	V	H	0.0000
106	A	H	0.0000
107	R	H	0.0000
108	A	H	-0.5974
109	A	H	-0.8124
110	W	H	-0.6536
111	G	H	-0.8879
111A	T	H	-0.9435
112A	D	H	-1.8793
112	Y	H	-0.9108
113	R	H	-2.1659
114	E	H	-1.7154
115	Q	H	-1.4340
116	G	H	-0.6178
117	Y	H	0.1791
118	W	H	0.4112
119	G	H	-0.1440
120	Q	H	-1.0969
121	G	H	-0.5734
122	T	H	-0.6980
123	Q	H	-0.7325
124	V	H	0.0000
125	T	H	-0.1745
126	V	H	0.0000
127	S	H	-0.6440
128	S	H	-0.4591