Project name: query_structure

Status: done

Started: 2026-03-16 20:39:19
Settings
Chain sequence(s) A: MAASSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYVSGPQEFTVPGSKSTATISGLKPGVDYTITVYAYEFYSGEYSHFSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)
Show buried residues

Minimal score value
-2.5242
Maximal score value
2.0412
Average score
-0.3723
Total score value
-36.1109

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0668
2 A A 0.5074
3 A A 0.4162
4 S A 0.2131
5 S A 0.1541
6 V A 0.1847
7 P A 0.0000
8 T A -1.4262
9 K A -2.5242
10 L A 0.0000
11 E A -1.8520
12 V A 0.1282
13 V A 1.5306
14 A A 0.8789
15 A A 0.2909
16 T A -0.6196
17 P A -1.2150
18 T A -1.0561
19 S A -0.5716
20 L A 0.0000
21 L A 0.6943
22 I A 0.0000
23 S A -0.8660
24 W A 0.0000
25 D A -2.2539
26 A A -1.0073
27 P A -0.0415
28 A A 0.1557
29 V A 0.5303
30 T A 0.4012
31 V A 0.0419
32 D A -0.5213
33 H A -0.6994
34 Y A 0.0000
35 V A -0.1087
36 I A 0.0000
37 T A -1.0776
38 Y A -1.0033
39 G A -0.9182
40 E A -1.0728
41 T A -0.8331
42 G A -0.0868
43 A A 0.6438
44 Y A 1.7538
45 V A 2.0412
46 S A 0.4738
47 G A -0.4597
48 P A -1.1776
49 Q A -2.2196
50 E A -2.1748
51 F A -0.6438
52 T A -0.1656
53 V A 0.0000
54 P A -1.1031
55 G A -1.2721
56 S A -1.3731
57 K A -2.0751
58 S A -1.3634
59 T A -0.7159
60 A A 0.0000
61 T A 0.2708
62 I A 0.0000
63 S A -0.6716
64 G A -1.0487
65 L A 0.0000
66 K A -2.3967
67 P A -1.7384
68 G A -1.4639
69 V A -1.3695
70 D A -1.7898
71 Y A 0.0000
72 T A -0.8929
73 I A 0.0000
74 T A -0.2152
75 V A 0.0000
76 Y A 0.1516
77 A A 0.0000
78 Y A 0.3100
79 E A 0.7938
80 F A 1.8879
81 Y A 1.5733
82 S A 0.2411
83 G A -0.3295
84 E A -0.6228
85 Y A 0.9982
86 S A 0.2241
87 H A -0.3666
88 F A 0.0526
89 S A -0.0965
90 P A 0.1284
91 I A 0.2657
92 S A -0.2469
93 I A -0.4225
94 N A -1.6167
95 Y A -1.3578
96 R A -2.4534
97 T A -1.5175
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018