Project name: RFC23

Chain sequence(s)	A: NTLTKSYNLNISAFTGNGTINYTRKVVLKATGGTDQTSPDMNITVNSTLSGGVWTSTAVTKSYTLTVTAPAGATITTEETGGLSIKSTGAISNLTIDELTTTTTTAA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)

• Minimal score value: -2.7472
• Maximal score value: 1.3946
• Average score: -0.5378
• Total score value: -57.5428

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-0.3643
2	T	A	-0.2043
3	L	A	0.0000
4	T	A	-0.2297
5	K	A	-0.1763
6	S	A	0.1689
7	Y	A	0.0000
8	N	A	-0.9266
9	L	A	0.0000
10	N	A	-1.4474
11	I	A	0.0000
12	S	A	-0.3852
13	A	A	-0.2898
14	F	A	0.0000
15	T	A	0.1133
16	G	A	0.0005
17	N	A	-0.5325
18	G	A	-0.8415
19	T	A	-0.8003
20	I	A	0.0000
21	N	A	-0.3677
22	Y	A	0.0000
23	T	A	-1.1646
24	R	A	-1.7104
25	K	A	-2.3263
26	V	A	0.0000
27	V	A	-1.5162
28	L	A	0.0000
29	K	A	-1.7830
30	A	A	0.0000
31	T	A	-0.8621
32	G	A	-1.0153
33	G	A	-1.1900
34	T	A	-1.4942
35	D	A	-2.4108
36	Q	A	-1.5559
37	T	A	-1.2849
38	S	A	0.0000
39	P	A	-1.2048
40	D	A	-2.4041
41	M	A	-1.8119
42	N	A	-1.9912
43	I	A	-0.9578
44	T	A	-0.6756
45	V	A	0.0000
46	N	A	-1.2693
47	S	A	-0.2981
48	T	A	0.2378
49	L	A	1.0976
50	S	A	0.4419
51	G	A	-0.0766
52	G	A	0.2739
53	V	A	1.3946
54	W	A	0.9847
55	T	A	0.3323
56	S	A	-0.2264
57	T	A	-0.2441
58	A	A	0.1027
59	V	A	-0.1715
60	T	A	-1.2364
61	K	A	-1.5931
62	S	A	-0.6746
63	Y	A	0.3004
64	T	A	0.1569
65	L	A	0.0000
66	T	A	-0.4686
67	V	A	0.0000
68	T	A	-0.6155
69	A	A	0.0000
70	P	A	-0.5530
71	A	A	-0.4015
72	G	A	-0.5592
73	A	A	-0.4388
74	T	A	-0.2867
75	I	A	-0.2993
76	T	A	-0.8226
77	T	A	-1.2472
78	E	A	-2.3737
79	E	A	-2.7472
80	T	A	-1.7785
81	G	A	-1.2960
82	G	A	-0.4345
83	L	A	0.8113
84	S	A	0.4816
85	I	A	0.9267
86	K	A	-0.9806
87	S	A	-0.7878
88	T	A	-0.8064
89	G	A	-0.7563
90	A	A	-0.3262
91	I	A	-0.1253
92	S	A	-0.6263
93	N	A	-1.1816
94	L	A	-0.4123
95	T	A	-0.6598
96	I	A	-0.6650
97	D	A	-2.0473
98	E	A	-1.7225
99	L	A	0.2584
100	T	A	0.3162
101	T	A	0.1407
102	T	A	-0.0804
103	T	A	-0.2099
104	T	A	-0.2315
105	T	A	-0.1827
106	A	A	-0.1239
107	A	A	-0.1203