Project name: ozomab

Status: done

Started: 2026-03-19 11:49:23
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSEINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-2.9024
Maximal score value
1.7636
Average score
-0.6113
Total score value
-70.2991

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.0645
2 V A -1.4604
3 Q A -1.6097
4 L A 0.0000
5 V A 0.9582
6 E A 0.0000
7 S A -0.1089
8 G A -0.7160
9 G A 0.1477
10 G A 0.6568
11 L A 1.3446
12 V A 0.0000
13 Q A -1.4001
14 P A -1.6155
15 G A -1.4026
16 G A -1.0244
17 S A -1.4573
18 L A -1.0133
19 R A -2.1084
20 L A 0.0000
21 S A -0.3343
22 C A 0.0000
23 A A -0.0671
24 A A 0.0000
25 S A -0.9905
26 G A -1.2244
27 F A -0.6623
28 T A -0.6104
29 F A 0.0000
30 S A -1.3014
31 D A -1.6728
32 Y A -0.2437
33 W A 0.2480
34 M A 0.0000
35 Y A -0.1905
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8220
40 A A -1.1764
41 P A -1.1474
42 G A -1.5263
43 K A -2.3178
44 G A -1.4371
45 L A -0.5056
46 E A -0.6959
47 W A 0.0037
48 V A 0.0000
49 S A 0.0000
50 E A -0.2912
51 I A 0.0000
52 N A 0.0000
53 T A -0.5220
54 N A -0.9533
55 G A 0.2085
56 L A 1.7636
57 I A 1.6702
58 T A 0.3808
59 K A -1.5021
60 Y A -1.6473
61 P A -1.7183
62 D A -2.7231
63 S A -1.8002
64 V A 0.0000
65 K A -2.9024
66 G A -1.9088
67 R A -1.8603
68 F A 0.0000
69 T A -1.2138
70 I A 0.0000
71 S A -0.2229
72 R A -0.9490
73 D A -1.5901
74 N A -1.9974
75 A A -1.3339
76 K A -2.2451
77 N A -1.6492
78 T A -0.9163
79 L A 0.0000
80 Y A -0.5261
81 L A 0.0000
82 Q A -1.5425
83 M A 0.0000
84 N A -2.0732
85 S A -1.4321
86 L A 0.0000
87 R A -2.2853
88 P A -1.9311
89 E A -2.3272
90 D A 0.0000
91 T A -0.4956
92 A A 0.0000
93 V A 0.7016
94 Y A 0.0000
95 Y A -0.0915
96 C A 0.0000
97 A A 0.0000
98 R A -0.2932
99 S A 0.0381
100 P A -0.1239
101 S A 0.0671
102 G A 0.0000
103 F A 0.9537
104 N A -0.8797
105 R A -1.3689
106 G A -0.9273
107 Q A -1.3134
108 G A -0.1584
109 T A 0.6278
110 L A 1.6845
111 V A 0.0000
112 T A 0.2814
113 V A 0.0000
114 S A -0.8472
115 S A -0.5651
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018