Project name: query_structure

Status: done

Started: 2026-03-17 01:09:31
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDFYIITYGETGGSWYSSQEFAVPGSKSTATISGLKPGVDYTITVYASMPGSWYYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-3.5647
Maximal score value
2.0686
Average score
-0.5116
Total score value
-47.0655

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.5223
2 S A 0.0085
3 D A -0.6880
4 V A -0.4796
5 P A 0.0000
6 R A -3.5647
7 D A -3.5429
8 L A 0.0000
9 E A -2.1318
10 V A 0.1478
11 V A 1.5715
12 A A 0.9218
13 A A 0.3326
14 T A -0.3353
15 P A -1.1261
16 T A -1.0098
17 S A -0.5221
18 L A 0.0000
19 L A 0.8047
20 I A 0.0000
21 S A -1.1784
22 W A 0.0000
23 D A -3.3326
24 A A -1.8284
25 P A -0.7137
26 A A 0.2518
27 V A 0.3028
28 T A -0.2980
29 V A -0.7727
30 D A -1.5383
31 F A -0.5055
32 Y A 0.0000
33 I A 0.2741
34 I A 0.0000
35 T A 0.0000
36 Y A -0.8063
37 G A -1.0673
38 E A -2.0002
39 T A -1.3806
40 G A -0.9776
41 G A -0.8176
42 S A 0.2395
43 W A 1.1942
44 Y A 1.4691
45 S A 0.0589
46 S A -0.5373
47 Q A -1.4921
48 E A -1.9433
49 F A -0.4222
50 A A 0.1607
51 V A 0.0000
52 P A -0.9122
53 G A -1.1040
54 S A -1.3119
55 K A -1.9899
56 S A -1.3791
57 T A -0.7571
58 A A 0.0000
59 T A 0.2614
60 I A 0.0000
61 S A -0.6532
62 G A -1.0309
63 L A 0.0000
64 K A -2.4268
65 P A -1.6669
66 G A -1.4565
67 V A -1.5296
68 D A -2.2587
69 Y A 0.0000
70 T A -1.1624
71 I A 0.0000
72 T A -0.2293
73 V A 0.0000
74 Y A 0.8778
75 A A 0.0000
76 S A 0.0000
77 M A 0.0597
78 P A -0.4464
79 G A -0.3762
80 S A 0.8207
81 W A 1.9081
82 Y A 2.0686
83 Y A 1.7291
84 S A 0.4811
85 P A 0.1289
86 I A -0.1829
87 S A -0.6753
88 I A -0.7058
89 N A -1.7800
90 Y A -1.5201
91 R A -2.5847
92 T A -1.5089
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018