Project name: d2ee215c4776354

Status: done

Started: 2026-06-22 16:06:59
Settings
Chain sequence(s) B: LEAEIMKLTEEIKKLMKEAVEKLKEDPEEAEKVLEEVKKKMAELQALVAA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:16)
Show buried residues

Minimal score value
-4.218
Maximal score value
1.4823
Average score
-1.9917
Total score value
-99.5858

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 0.4794
2 E B -1.1770
3 A B -1.1428
4 E B -1.8685
5 I B -0.9821
6 M B -0.9882
7 K B -2.8482
8 L B 0.0000
9 T B -2.1935
10 E B -3.6755
11 E B -3.6310
12 I B 0.0000
13 K B -3.9500
14 K B -3.7589
15 L B -3.0112
16 M B -2.0127
17 K B -2.7780
18 E B -2.5648
19 A B 0.0000
20 V B -0.8941
21 E B -2.5903
22 K B -3.2391
23 L B -2.0409
24 K B -2.8419
25 E B -3.4734
26 D B -3.3322
27 P B -2.8958
28 E B -3.6542
29 E B -3.7839
30 A B 0.0000
31 E B -3.8704
32 K B -4.2053
33 V B 0.0000
34 L B -3.0077
35 E B -4.2180
36 E B -3.6039
37 V B 0.0000
38 K B -3.6650
39 K B -3.9171
40 K B -3.1088
41 M B -2.1158
42 A B -1.9571
43 E B -2.2548
44 L B -1.1073
45 Q B -0.8783
46 A B -0.2422
47 L B 0.5232
48 V B 1.4823
49 A B 0.5974
50 A B 0.8118
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018