Project name: d2f7dc478f6a015

Chain sequence(s)	A: KSRHYKIYHDQIKYGREFSEKVHKPGVTEEETKELIELHKKVMRAINEGKPADLL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:59)

• Minimal score value: -4.2682
• Maximal score value: 0.9784
• Average score: -2.0914
• Total score value: -115.0287

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.2455
2	S	A	-1.8532
3	R	A	-2.7190
4	H	A	-1.7359
5	Y	A	-0.3294
6	K	A	-1.5556
7	I	A	-1.1426
8	Y	A	0.5717
9	H	A	-0.1627
10	D	A	-0.7496
11	Q	A	-0.7241
12	I	A	-0.3152
13	K	A	-1.7331
14	Y	A	-1.9176
15	G	A	-2.0006
16	R	A	-3.5248
17	E	A	-3.7069
18	F	A	-2.3789
19	S	A	-2.8631
20	E	A	-4.2682
21	K	A	-3.7816
22	V	A	-2.8663
23	H	A	-2.7377
24	K	A	-3.2029
25	P	A	-1.8007
26	G	A	-1.3211
27	V	A	-1.8587
28	T	A	-2.5172
29	E	A	-3.7287
30	E	A	-4.2332
31	E	A	-4.0318
32	T	A	-3.5623
33	K	A	-4.1763
34	E	A	-3.9359
35	L	A	-2.4900
36	I	A	-1.9821
37	E	A	-3.0687
38	L	A	-1.4546
39	H	A	-1.7741
40	K	A	-2.4772
41	K	A	-2.6604
42	V	A	0.0000
43	M	A	-2.5522
44	R	A	-3.7196
45	A	A	0.0000
46	I	A	0.0000
47	N	A	-3.4072
48	E	A	-3.4801
49	G	A	-3.2060
50	K	A	-2.3958
51	P	A	-1.2108
52	A	A	-1.0770
53	D	A	-0.9171
54	L	A	0.9784
55	L	A	0.9745