Project name: eMA

Chain sequence(s)	A: MFDASNFKDFSSIASASSSWQNQHGSTMIIQVDSFGNVSGQYVNRAEGTGCQNSPYPLTGRVNGTFIDFSVKWNNSTENCNSNTQWTGYAQVNGNNTEIVTRWNLKYEGGSGPAIWQGQDTFQYVPTTE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -2.7755
• Maximal score value: 1.5901
• Average score: -0.826
• Total score value: -106.5478

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8327
2	F	A	-0.0767
3	D	A	-1.2091
4	A	A	-1.1770
5	S	A	-1.7090
6	N	A	-2.1449
7	F	A	0.0000
8	K	A	-2.2073
9	D	A	-1.4709
10	F	A	0.0000
11	S	A	-0.9271
12	S	A	-1.0979
13	I	A	0.0000
14	A	A	-0.6195
15	S	A	-0.7951
16	A	A	-0.3955
17	S	A	-0.3585
18	S	A	0.0000
19	S	A	-0.0060
20	W	A	0.0000
21	Q	A	-0.9403
22	N	A	0.0000
23	Q	A	-1.9683
24	H	A	-1.7865
25	G	A	-1.3650
26	S	A	0.0000
27	T	A	-0.6904
28	M	A	0.0000
29	I	A	0.2269
30	I	A	0.0000
31	Q	A	-1.6131
32	V	A	0.0000
33	D	A	-1.0523
34	S	A	0.1299
35	F	A	1.0034
36	G	A	-0.7034
37	N	A	-1.3638
38	V	A	0.0000
39	S	A	-1.2021
40	G	A	-0.7372
41	Q	A	-0.6989
42	Y	A	0.0000
43	V	A	0.0000
44	N	A	0.0000
45	R	A	-2.5087
46	A	A	-2.2673
47	E	A	-2.6245
48	G	A	-1.7035
49	T	A	-1.4089
50	G	A	-1.6930
51	C	A	0.0000
52	Q	A	-2.7589
53	N	A	-2.2132
54	S	A	-1.5598
55	P	A	-0.9628
56	Y	A	0.0000
57	P	A	-0.9180
58	L	A	0.0000
59	T	A	-1.1987
60	G	A	-1.4229
61	R	A	-1.7223
62	V	A	0.0000
63	N	A	-1.2403
64	G	A	-1.1084
65	T	A	-0.2950
66	F	A	0.5556
67	I	A	0.0000
68	D	A	-1.4171
69	F	A	0.0000
70	S	A	-1.1590
71	V	A	0.0000
72	K	A	-1.9544
73	W	A	0.0000
74	N	A	-2.1050
75	N	A	-1.5135
76	S	A	-1.0388
77	T	A	-1.2618
78	E	A	-2.4936
79	N	A	-2.3463
80	C	A	-1.8617
81	N	A	-2.2955
82	S	A	-1.4942
83	N	A	-1.3135
84	T	A	0.0000
85	Q	A	-1.9776
86	W	A	0.0000
87	T	A	-1.0642
88	G	A	-0.0757
89	Y	A	0.6233
90	A	A	0.0000
91	Q	A	0.1157
92	V	A	-0.0320
93	N	A	-1.3329
94	G	A	-1.4118
95	N	A	-1.8352
96	N	A	-1.4536
97	T	A	0.0000
98	E	A	-0.5325
99	I	A	0.0000
100	V	A	-0.1486
101	T	A	0.0000
102	R	A	-2.7755
103	W	A	-1.8386
104	N	A	-0.9935
105	L	A	-0.2294
106	K	A	-0.8327
107	Y	A	-0.6651
108	E	A	-1.9939
109	G	A	-1.0271
110	G	A	-1.0624
111	S	A	-0.9039
112	G	A	-0.8213
113	P	A	-0.8278
114	A	A	0.1949
115	I	A	1.5901
116	W	A	1.2803
117	Q	A	-1.1520
118	G	A	-1.6491
119	Q	A	-2.3992
120	D	A	0.0000
121	T	A	-1.0656
122	F	A	0.0000
123	Q	A	-1.3996
124	Y	A	-0.3366
125	V	A	0.3387
126	P	A	-0.2228
127	T	A	-0.3462
128	T	A	-0.9508
129	E	A	-1.9057