Project name: d3372061e24002a

Chain sequence(s)	A: MAAVLLPVLLAAPFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAERNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:54)

• Minimal score value: -3.6154
• Maximal score value: 3.5146
• Average score: -0.6885
• Total score value: -105.345

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.3105
2	A	A	1.2860
3	A	A	1.8489
4	V	A	3.1057
5	L	A	3.3648
6	L	A	3.4130
7	P	A	2.7617
8	V	A	3.5146
9	L	A	3.3447
10	L	A	2.7970
11	A	A	1.9478
12	A	A	1.0621
13	P	A	0.5918
14	F	A	1.3877
15	N	A	0.0110
16	L	A	0.5816
17	P	A	-0.2134
18	P	A	-0.5073
19	G	A	-0.9076
20	N	A	-2.2539
21	Y	A	-2.1198
22	K	A	-3.0563
23	K	A	-2.9227
24	P	A	-1.7815
25	K	A	-0.8185
26	L	A	0.0000
27	L	A	0.0000
28	Y	A	0.0158
29	C	A	0.0000
30	S	A	-0.7175
31	N	A	0.0000
32	G	A	-1.8877
33	G	A	-1.2963
34	H	A	0.0000
35	F	A	0.0000
36	L	A	0.0000
37	R	A	-0.9457
38	I	A	0.0000
39	L	A	-0.9305
40	P	A	-1.4941
41	D	A	-1.8247
42	G	A	-1.0598
43	T	A	-0.5100
44	V	A	0.0000
45	D	A	-0.5808
46	G	A	-1.3713
47	T	A	-2.1056
48	R	A	-3.1907
49	D	A	-3.6154
50	R	A	-3.3504
51	S	A	-2.2083
52	D	A	-2.3719
53	Q	A	-2.4392
54	H	A	-1.7591
55	I	A	0.0000
56	Q	A	-1.6837
57	L	A	0.0000
58	Q	A	-1.9484
59	L	A	0.0000
60	S	A	-1.4752
61	A	A	-0.8454
62	E	A	-1.6020
63	S	A	-0.2861
64	V	A	0.8895
65	G	A	0.1073
66	E	A	-0.6015
67	V	A	0.0000
68	Y	A	-0.8722
69	I	A	0.0000
70	K	A	-1.2123
71	S	A	0.0000
72	T	A	-1.6359
73	E	A	-2.4172
74	T	A	-1.6336
75	G	A	-1.1994
76	Q	A	0.0000
77	Y	A	-0.5821
78	L	A	0.0000
79	A	A	0.0000
80	M	A	0.0000
81	D	A	-1.1858
82	T	A	-1.1858
83	D	A	-1.9000
84	G	A	0.0000
85	L	A	-0.2871
86	L	A	0.0000
87	Y	A	0.0286
88	G	A	-0.6063
89	S	A	0.0000
90	Q	A	-1.3948
91	T	A	-0.9211
92	P	A	-1.1730
93	N	A	-1.7387
94	E	A	-2.6729
95	E	A	-1.8460
96	C	A	0.0000
97	L	A	0.0000
98	F	A	0.0000
99	L	A	-0.3586
100	E	A	-0.2947
101	R	A	-0.4733
102	L	A	-0.1733
103	E	A	-1.4280
104	E	A	-2.6368
105	N	A	-2.4996
106	H	A	-1.9835
107	Y	A	-1.0613
108	N	A	-0.6143
109	T	A	0.0000
110	Y	A	0.0000
111	I	A	0.0000
112	S	A	0.0000
113	K	A	-2.2752
114	K	A	-2.5691
115	H	A	0.0000
116	A	A	-2.4063
117	E	A	-3.3130
118	R	A	-3.5481
119	N	A	-2.8684
120	W	A	-1.9597
121	F	A	0.0000
122	V	A	0.0000
123	G	A	0.0000
124	L	A	0.0000
125	K	A	-2.5745
126	K	A	-3.0621
127	N	A	-2.4703
128	G	A	0.0000
129	S	A	-1.2364
130	C	A	-0.8016
131	K	A	-1.3966
132	R	A	-1.7180
133	G	A	0.0000
134	P	A	-2.1166
135	R	A	-2.5025
136	T	A	0.0000
137	H	A	-1.5851
138	Y	A	0.1356
139	G	A	-0.6227
140	Q	A	-1.3214
141	K	A	-2.1279
142	A	A	0.0000
143	I	A	0.0000
144	L	A	-0.5796
145	F	A	0.0000
146	L	A	0.1986
147	P	A	0.2325
148	L	A	0.4504
149	P	A	-0.4177
150	V	A	-0.1148
151	S	A	-0.4434
152	S	A	-1.1653
153	D	A	-1.8660