Project name: design4

Status: done

Started: 2026-05-21 06:30:42
Settings
Chain sequence(s) A: ARMGGVVGSGGTLVGLLEVGKELGIGAERVYGGGRQPAEKVLAAARAAGVPRAGHTGTGVAAALEATPLEEIRVVLTTDVASDPERDFPVLRRLAEAAGATLLIQPYNEETRPLVRTDPEKTRKAFFDDDREAAIALLDRVVAA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:19)
Show buried residues

Minimal score value
-4.0131
Maximal score value
0.9707
Average score
-1.2905
Total score value
-185.8341

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.8494
2 R A -2.3179
3 M A 0.0000
4 G A -1.3621
5 G A 0.0000
6 V A 0.0000
7 V A 0.0000
8 G A 0.0000
9 S A -0.4499
10 G A 0.0000
11 G A -0.7179
12 T A -0.2953
13 L A 0.0000
14 V A 0.0000
15 G A 0.0000
16 L A 0.0000
17 L A 0.0000
18 E A -2.9208
19 V A 0.0000
20 G A 0.0000
21 K A -3.2507
22 E A -2.7124
23 L A -0.7842
24 G A -1.5584
25 I A -1.7332
26 G A -1.9292
27 A A 0.0000
28 E A -2.0115
29 R A -1.6117
30 V A 0.0000
31 Y A 0.0517
32 G A 0.0000
33 G A 0.0000
34 G A -1.4709
35 R A -2.5699
36 Q A 0.0000
37 P A -1.5760
38 A A -1.4970
39 E A -2.1383
40 K A -1.8119
41 V A 0.0000
42 L A -1.1977
43 A A -1.2534
44 A A 0.0000
45 A A 0.0000
46 R A -2.2511
47 A A -1.5066
48 A A -2.2374
49 G A -1.7544
50 V A 0.0000
51 P A -1.8802
52 R A -2.4711
53 A A -1.2429
54 G A -0.5625
55 H A -0.7066
56 T A -0.5547
57 G A -1.1655
58 T A -0.7453
59 G A -0.7311
60 V A -0.4022
61 A A -0.6915
62 A A -0.5974
63 A A 0.0000
64 L A 0.0000
65 E A -1.6005
66 A A -0.7730
67 T A 0.0000
68 P A -1.1655
69 L A -1.6407
70 E A -2.4206
71 E A -2.1650
72 I A 0.0000
73 R A -2.2914
74 V A 0.0000
75 V A 0.0000
76 L A 0.0000
77 T A 0.2532
78 T A 0.1589
79 D A -0.3559
80 V A -0.3969
81 A A -1.1102
82 S A -1.3468
83 D A -2.6371
84 P A -2.4825
85 E A -3.3059
86 R A -3.3296
87 D A -2.4143
88 F A -1.7202
89 P A -1.5823
90 V A -1.3221
91 L A 0.0000
92 R A -2.1883
93 R A -2.6912
94 L A -1.7262
95 A A 0.0000
96 E A -2.6616
97 A A -1.7610
98 A A -2.0841
99 G A -1.9803
100 A A -1.7475
101 T A -0.7913
102 L A -0.0365
103 L A 0.6572
104 I A 0.9707
105 Q A -0.0112
106 P A -0.5411
107 Y A -1.5396
108 N A -2.9721
109 E A -3.5542
110 E A -3.3120
111 T A -2.3702
112 R A -2.4038
113 P A -1.8696
114 L A -1.7783
115 V A -1.6118
116 R A -2.5037
117 T A -1.9460
118 D A -2.3848
119 P A -2.2116
120 E A -2.1363
121 K A -2.6074
122 T A -2.3906
123 R A -2.2583
124 K A -3.3296
125 A A -2.5038
126 F A -2.1962
127 F A 0.0000
128 D A -4.0131
129 D A -3.9597
130 D A -3.4355
131 R A -3.0134
132 E A -2.6545
133 A A -1.5058
134 A A 0.0000
135 I A -0.8738
136 A A -1.2492
137 L A -1.0390
138 L A 0.0000
139 D A -2.4597
140 R A -2.3714
141 V A 0.0000
142 V A -1.3923
143 A A -1.2863
144 A A -0.9912
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018