Project name: c57f611504a66db [mutate: LV105H] [mutate: FA28H, VI105H] [mutate: IV105H] [mutate: VL105H]

Status: done

Started: 2026-06-04 14:56:36
Settings
Chain sequence(s) H: EVQLLESGGGLVQPGGSLRLSCAMSGHAFNLYIMAWFRQAPGKEREFVAGVSTSGRTSLYADSVKGRFTISRDNSKTTGYLQMNSLKSEDTAVYYCAARSSASEVWVPSGDEYYAWWGQGTTVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VL105H
Energy difference between WT (input) and mutated protein (by FoldX) -0.412095 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:28)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:35)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)
Show buried residues

Minimal score value
-3.7349
Maximal score value
1.5278
Average score
-0.74
Total score value
-93.9785

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E H -2.3358
2 V H 0.0000
3 Q H -1.3985
4 L H 0.0000
5 L H 0.8634
6 E H -0.0067
7 S H -0.4596
8 G H -1.0868
9 G H -0.4948
10 G H 0.2273
11 L H 1.1263
12 V H 0.0000
13 Q H -1.4700
14 P H -1.7329
15 G H -1.4690
16 G H -0.9755
17 S H -1.2822
18 L H -0.9504
19 R H -2.1666
20 L H 0.0000
21 S H -0.4756
22 C H 0.0000
23 A H -0.1009
24 M H 0.0000
25 S H -0.9995
26 G H -1.6895
27 H H -1.5284
28 A H -0.8508
29 F H 0.0000
30 N H -1.3717
31 L H 0.0560
32 Y H 0.1091
33 I H 0.0000
34 M H 0.0000
35 A H 0.0000
36 W H 0.0000
37 F H 0.0000
38 R H -1.5640
39 Q H -2.2177
40 A H -1.9680
41 P H -1.4185
42 G H -1.9714
43 K H -3.4668
44 E H -3.7349
45 R H -3.2352
46 E H -3.2020
47 F H 0.0000
48 V H 0.0000
49 A H 0.0000
50 G H 0.0000
51 V H 0.0000
52 S H 0.0000
53 T H -0.4931
54 S H -0.9398
55 G H -1.7034
56 R H -1.9304
57 T H -0.5900
58 S H -0.2651
59 L H 0.1543
60 Y H -0.7319
61 A H -1.5420
62 D H -2.4959
63 S H -1.8506
64 V H 0.0000
65 K H -2.6152
66 G H -1.8008
67 R H -1.5643
68 F H 0.0000
69 T H -0.8545
70 I H 0.0000
71 S H -0.8092
72 R H -1.4756
73 D H -1.9627
74 N H -2.3953
75 S H -1.9560
76 K H -2.3695
77 T H -1.9424
78 T H 0.0000
79 G H 0.0000
80 Y H -0.6715
81 L H 0.0000
82 Q H -1.3410
83 M H 0.0000
84 N H -1.4007
85 S H -1.2629
86 L H 0.0000
87 K H -2.5106
88 S H -2.0266
89 E H -2.3208
90 D H 0.0000
91 T H -0.7842
92 A H 0.0000
93 V H -0.0378
94 Y H 0.0000
95 Y H -0.2879
96 C H 0.0000
97 A H 0.0000
98 A H 0.0000
99 R H -0.0388
100 S H -0.0087
101 S H 0.2600
102 A H 0.1502
103 S H -0.0388
104 E H 0.3556
105 L H 1.4834 mutated: VL105H
106 W H 1.5278
107 V H 0.0000
108 P H 0.0000
109 S H -0.5818
110 G H -1.3070
111 D H -2.0047
112 E H -1.9226
113 Y H -0.4264
114 Y H 0.0000
115 A H -0.0592
116 W H 0.1168
117 W H 0.0206
118 G H -0.2784
119 Q H -0.9712
120 G H -0.4206
121 T H -0.2714
122 T H 0.0684
123 V H 0.0000
124 T H -0.1051
125 V H 0.0000
126 S H -0.5710
127 S H -0.9366
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018