Project name: obj1 [mutate: AN92C, IQ93C, YG94C, YK95C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IQ93C,AN92C,YK95C,YG94C
Energy difference between WT (input) and mutated protein (by FoldX)	14.3725 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:06)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:06)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:06)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:06)
[INFO]       FoldX:    Building mutant model                                                       (00:00:30)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:31)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)

• Minimal score value: -3.3308
• Maximal score value: 1.5458
• Average score: -0.7099
• Total score value: -85.1901

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9429
3	Q	C	-1.2758
4	L	C	0.0000
5	V	C	0.4865
6	E	C	0.1079
7	S	C	-0.4105
8	G	C	-0.8183
9	G	C	-0.1259
10	G	C	0.8197
11	L	C	1.4403
12	V	C	-0.0379
13	Q	C	-1.3363
14	P	C	-1.4883
15	G	C	-1.4134
16	G	C	-0.9789
17	S	C	-1.2324
18	L	C	-0.9661
19	R	C	-2.1482
20	L	C	0.0000
21	S	C	-0.5426
22	C	C	0.0000
23	A	C	-0.1957
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1431
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.8760
40	A	C	-1.2895
41	P	C	-1.4688
42	G	C	-1.4682
43	K	C	-2.1896
44	G	C	-1.1599
45	L	C	0.0228
46	E	C	-0.4360
47	W	C	0.2684
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3547
61	A	C	-1.1271
62	D	C	-2.3407
63	S	C	-1.7076
64	V	C	0.0000
65	K	C	-2.3826
66	G	C	-1.6166
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6697
81	L	C	0.0000
82	Q	C	-1.2344
83	M	C	0.0000
84	N	C	-1.3335
85	S	C	-1.2327
86	L	C	0.0000
87	R	C	-2.4719
88	A	C	-1.8889
89	E	C	-2.3436
90	D	C	0.0000
91	T	C	-0.6346
92	N	C	0.0000	mutated: AN92C
93	Q	C	-0.1006	mutated: IQ93C
94	G	C	0.0000	mutated: YG94C
95	K	C	-0.1531	mutated: YK95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1852
101	D	C	-3.3308
102	G	C	-2.0842
103	F	C	-1.2284
104	N	C	-2.4259
105	K	C	-3.1810
106	G	C	-1.8986
107	F	C	-1.0135
108	D	C	-1.1473
109	Y	C	-0.3122
110	W	C	0.2359
111	G	C	0.0000
112	Q	C	-1.1340
113	G	C	-0.4128
114	T	C	0.1445
115	L	C	1.2545
116	V	C	0.0000
117	T	C	0.1905
118	V	C	0.0000
119	S	C	-0.7737
120	S	C	-1.0597