Project name: query_structure

Status: done

Started: 2026-03-17 00:07:36
Settings
Chain sequence(s) A: MGEVQLVESGGGSVQAGGSLRLSCAASGVSNTDMIMIWFRQAPGKEREGVLAAIYKNSTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAIYYCAAIAFNGHNHPILTIYWGQGTQVTVGGGS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:39)
Show buried residues

Minimal score value
-3.3438
Maximal score value
2.5151
Average score
-0.683
Total score value
-86.0562

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4679
2 G A -0.9712
3 E A -1.9690
4 V A -0.8636
5 Q A -0.9614
6 L A 0.0000
7 V A 1.2389
8 E A 0.1983
9 S A -0.6547
10 G A -1.2808
11 G A -1.1967
12 G A -0.9432
13 S A -0.7341
14 V A -0.8473
15 Q A -1.8343
16 A A -1.8997
17 G A -1.4035
18 G A -1.0383
19 S A -1.1742
20 L A -1.1443
21 R A -2.1848
22 L A 0.0000
23 S A -0.4689
24 C A 0.0000
25 A A -0.0666
26 A A 0.0000
27 S A -0.7883
28 G A -0.8434
29 V A -0.4047
30 S A -0.9654
31 N A 0.0000
32 T A -1.6792
33 D A -1.5997
34 M A 0.0000
35 I A 0.3047
36 M A 0.0000
37 I A 0.0000
38 W A 0.0000
39 F A 0.1344
40 R A -0.8573
41 Q A -1.6926
42 A A -1.8269
43 P A -1.5679
44 G A -1.9341
45 K A -3.2031
46 E A -3.3438
47 R A -2.3600
48 E A -1.7014
49 G A -0.7894
50 V A 0.4431
51 L A 0.0000
52 A A 0.0000
53 A A 0.7899
54 I A 0.0000
55 Y A -0.7457
56 K A -2.3002
57 N A -2.0665
58 S A -0.8667
59 T A 0.1260
60 Y A 1.0559
61 Y A -0.1292
62 A A -0.9894
63 D A -2.3355
64 S A -1.8201
65 V A 0.0000
66 K A -2.4600
67 G A -1.7779
68 R A -1.4699
69 F A 0.0000
70 T A -0.7326
71 I A 0.0000
72 S A -0.7002
73 Q A -1.5616
74 D A -1.9410
75 N A -2.2957
76 A A -1.7105
77 K A -2.4478
78 N A -1.7842
79 T A 0.0000
80 V A 0.0000
81 Y A 0.0000
82 L A 0.0000
83 Q A -1.2760
84 M A 0.0000
85 N A -1.3724
86 S A -1.1530
87 L A 0.0000
88 K A -2.3711
89 P A -2.0362
90 E A -2.3921
91 D A 0.0000
92 T A -1.1281
93 A A 0.0000
94 I A -0.3999
95 Y A 0.0000
96 Y A 0.0909
97 C A 0.0000
98 A A 0.0000
99 A A 0.0000
100 I A 1.5758
101 A A 1.0812
102 F A 0.9999
103 N A -0.5523
104 G A -1.4129
105 H A -1.9834
106 N A -2.3265
107 H A -1.4603
108 P A -0.1593
109 I A 1.7879
110 L A 2.5151
111 T A 2.0128
112 I A 2.5025
113 Y A 1.2275
114 W A 1.1863
115 G A 0.2177
116 Q A -0.7246
117 G A -0.4232
118 T A 0.0000
119 Q A -1.2801
120 V A 0.0000
121 T A -1.0192
122 V A 0.0000
123 G A -1.4981
124 G A -1.6087
125 G A -1.3842
126 S A -0.7228
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018