Project name: query_structure

Status: done

Started: 2026-03-16 23:06:31
Settings
Chain sequence(s) A: DVQLQESGGGLVQPGGSLRLSCAASGFLFSDTYMTWARQAPGKGLEWLGGISKDGSGTLYEDSVEGRFTISRDNAKNTLYLQMNSLKSEDTALYYCSTGALLPTRPQGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:52)
Show buried residues

Minimal score value
-3.1154
Maximal score value
2.2357
Average score
-0.8271
Total score value
-96.7715

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.7707
2 V A -0.5768
3 Q A -1.5212
4 L A 0.0000
5 Q A -1.4441
6 E A 0.0000
7 S A -1.1849
8 G A -1.2075
9 G A -0.8463
10 G A -0.0508
11 L A 1.0440
12 V A -0.0232
13 Q A -1.3432
14 P A -1.6983
15 G A -1.5532
16 G A -1.0920
17 S A -1.5479
18 L A -1.1388
19 R A -2.3393
20 L A 0.0000
21 S A -0.8360
22 C A 0.0000
23 A A -0.9282
24 A A 0.0000
25 S A -0.5782
26 G A -0.5680
27 F A 0.3126
28 L A 0.8053
29 F A 0.0000
30 S A -1.8365
31 D A -2.1302
32 T A -1.1718
33 Y A -1.0498
34 M A 0.0000
35 T A 0.0000
36 W A 0.0000
37 A A -0.3295
38 R A -0.9204
39 Q A -1.4396
40 A A 0.0000
41 P A -1.1940
42 G A -1.5666
43 K A -2.4592
44 G A -1.6578
45 L A -0.9790
46 E A -1.0891
47 W A 0.0967
48 L A 0.0000
49 G A 0.0000
50 G A 0.0000
51 I A 0.0000
52 S A -1.4849
53 K A -2.8493
54 D A -3.1154
55 G A -1.8567
56 S A -1.2182
57 G A -0.5506
58 T A 0.4737
59 L A 0.7311
60 Y A -0.6171
61 E A -1.9403
62 D A -2.7729
63 S A -1.9231
64 V A 0.0000
65 E A -2.8020
66 G A -2.0314
67 R A -1.7082
68 F A 0.0000
69 T A -0.9652
70 I A 0.0000
71 S A -0.4650
72 R A -1.3721
73 D A -1.6917
74 N A -2.1287
75 A A -1.3949
76 K A -2.2854
77 N A -1.4889
78 T A -1.2541
79 L A 0.0000
80 Y A -0.6212
81 L A 0.0000
82 Q A -1.6741
83 M A 0.0000
84 N A -2.1951
85 S A -1.5610
86 L A 0.0000
87 K A -2.4010
88 S A -1.9578
89 E A -2.3349
90 D A 0.0000
91 T A -0.9755
92 A A 0.0000
93 L A -0.5136
94 Y A 0.0000
95 Y A -0.8263
96 C A 0.0000
97 S A -0.5240
98 T A 0.1874
99 G A 0.3032
100 A A 1.0880
101 L A 2.2357
102 L A 1.8790
103 P A 0.2599
104 T A -0.4315
105 R A -1.8659
106 P A -1.5608
107 Q A -1.5457
108 G A -1.5242
109 Q A -1.7295
110 G A -1.1840
111 T A 0.0000
112 Q A -1.2288
113 V A 0.0000
114 T A -0.3062
115 V A 0.0000
116 S A -0.6782
117 S A -0.5606
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018