Project name: query_structure

Status: done

Started: 2026-03-16 23:27:34
Settings
Chain sequence(s) A: GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)
Show buried residues

Minimal score value
-2.818
Maximal score value
2.5743
Average score
-0.0215
Total score value
-0.9905

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4322
2 P A -0.0942
3 S A 0.4934
4 F A 1.6410
5 C A 0.6701
6 K A -1.0900
7 A A -1.6580
8 D A -2.5944
9 E A -2.8180
10 K A -2.3753
11 P A -1.1642
12 C A -0.8295
13 E A -1.1353
14 Y A 0.2664
15 H A -0.0460
16 A A 0.2218
17 D A -0.0036
18 C A 0.0000
19 C A 0.3314
20 N A -0.7746
21 C A 0.0000
22 C A 0.0000
23 L A -0.1088
24 S A -0.2126
25 G A -0.6304
26 I A -0.8834
27 C A 0.0000
28 A A -1.0703
29 P A -0.9352
30 S A -0.1894
31 T A 0.0000
32 N A -0.2288
33 W A 1.6469
34 I A 2.5743
35 L A 1.6914
36 P A 0.4591
37 G A 0.1134
38 C A -0.1312
39 S A -0.3516
40 T A -0.0057
41 S A 0.4532
42 S A 0.7704
43 F A 2.4202
44 F A 2.4046
45 K A 0.7661
46 I A 1.8485
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018