Project name: d4c80cc54d96599

Status: done

Started: 2026-06-26 03:36:49
Settings
Chain sequence(s) A: DFMLSQPHSVSESPGKTVTISCTRSSGLIGSNYVQWFQQRPGSAPTTVIYEDVQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDTKTWVFGGGTKLTVL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)
Show buried residues

Minimal score value
-2.5658
Maximal score value
1.8161
Average score
-0.4586
Total score value
-50.4465

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.7206
2 F A 0.0000
3 M A 0.5441
4 L A 0.0000
5 S A -0.1945
6 Q A -0.5374
7 P A -0.8742
8 H A -1.4338
9 S A -0.9199
10 V A -0.4370
11 S A -0.1574
12 E A -0.5739
13 S A -0.4419
14 P A -0.8913
15 G A -1.5909
16 K A -1.9844
17 T A -1.1935
18 V A 0.0000
19 T A -0.1759
20 I A 0.0000
21 S A -0.1554
22 C A 0.0000
23 T A -0.2567
24 R A -0.1378
25 S A -0.2876
26 S A -0.4016
27 G A -0.3485
28 L A 0.3670
29 I A 0.0000
30 G A -0.2659
31 S A -0.1051
32 N A -0.1711
33 Y A 0.5687
34 V A 0.0000
35 Q A 0.2220
36 W A 0.0000
37 F A 0.0671
38 Q A 0.0000
39 Q A -1.5048
40 R A -2.3462
41 P A -1.4241
42 G A -1.0153
43 S A -0.9248
44 A A -0.5460
45 P A -0.6926
46 T A -0.3209
47 T A -0.0576
48 V A 0.0000
49 I A 0.0000
50 Y A -0.1291
51 E A -0.5390
52 D A 0.0969
53 V A 0.9183
54 Q A -0.7405
55 R A -1.2066
56 P A -0.8858
57 S A -0.8551
58 G A -0.8292
59 V A -0.7661
60 P A -1.2482
61 D A -2.2033
62 R A -1.3365
63 F A 0.0000
64 S A -0.4286
65 G A 0.0000
66 S A -0.0262
67 I A -0.0064
68 D A -1.1625
69 S A -0.7590
70 S A -0.6172
71 S A -0.6166
72 N A -0.6338
73 S A -0.5814
74 A A 0.0000
75 S A -0.1136
76 L A 0.0000
77 T A -0.2410
78 I A 0.0000
79 S A -1.2126
80 G A -1.4250
81 L A 0.0000
82 Q A -1.8421
83 S A -1.5105
84 E A -2.5658
85 D A 0.0000
86 E A -2.0247
87 A A 0.0000
88 D A -1.6711
89 Y A 0.0000
90 Y A 0.1626
91 C A 0.0000
92 Q A 0.0000
93 S A 0.0000
94 Y A 0.5303
95 D A -0.4840
96 T A -1.0563
97 K A -1.4606
98 T A -0.3854
99 W A 1.1888
100 V A 0.0000
101 F A 1.8161
102 G A 0.5583
103 G A -0.4022
104 G A -0.6120
105 T A 0.0000
106 K A -1.4506
107 L A 0.0000
108 T A -0.3153
109 V A -0.2181
110 L A 1.1639
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018