Project name: d5346a4e784d1aa

Status: done

Started: 2026-04-20 02:22:28
Settings
Chain sequence(s) A: TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:51)
Show buried residues

Minimal score value
-3.8135
Maximal score value
1.2275
Average score
-1.2914
Total score value
-68.4436

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A 0.2566
2 I A 1.2275
3 D A -0.6289
4 Q A -0.8293
5 W A 0.6345
6 L A 0.4781
7 L A -1.2455
8 K A -2.7136
9 N A -2.5363
10 A A 0.0000
11 K A -3.1013
12 E A -3.8135
13 D A -3.7283
14 A A 0.0000
15 I A 0.0000
16 A A -2.8794
17 E A -3.4853
18 L A 0.0000
19 K A -3.1790
20 K A -3.1459
21 A A -1.9012
22 G A -1.6328
23 I A -1.0859
24 T A -0.8692
25 S A -0.6634
26 D A -1.0050
27 F A 0.8344
28 Y A -0.1363
29 F A -0.7386
30 N A -1.4110
31 A A -0.9160
32 I A 0.0000
33 N A -2.2549
34 K A -2.5335
35 A A -2.3201
36 K A -2.2746
37 T A -1.4911
38 V A -1.1078
39 E A -2.1929
40 E A -2.3334
41 V A 0.0000
42 N A -1.8965
43 A A -1.5734
44 L A -0.7789
45 K A -1.1829
46 N A -1.7799
47 E A -1.7786
48 I A 0.0000
49 L A -0.1697
50 K A -1.7919
51 A A -1.2712
52 H A -0.9772
53 A A -0.5205
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018