Project name: wtVHL1

Chain sequence(s)	A: QVQLQQSGPELVKPGASVRMSCKTSGYTFTDYVISWVKQRPGQGLEWIGEIFPRTGSTYYNENFKATATLTADKSSNTAYMQLSSLTSEDSAAYFCAFITSVDWAMEYWGQGTSVTVSS; C: RLLEMEFEERKRAAE
Selected Chain(s)	A,C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)

• Minimal score value: -3.4676
• Maximal score value: 0.9571
• Average score: -0.8181
• Total score value: -109.6206

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.2832
2	V	A	-0.7410
3	Q	A	-1.0062
4	L	A	0.0000
5	Q	A	-1.6998
6	Q	A	-1.2693
7	S	A	-1.1992
8	G	A	-0.8390
9	P	A	-0.6001
10	E	A	-0.5313
11	L	A	0.6979
12	V	A	-0.4535
13	K	A	-1.8162
14	P	A	-1.7484
15	G	A	-1.0231
16	A	A	-0.7509
17	S	A	-1.0312
18	V	A	0.0000
19	R	A	-2.0622
20	M	A	0.0000
21	S	A	-0.7284
22	C	A	0.0000
23	K	A	-1.5597
24	T	A	0.0000
25	S	A	-1.0843
26	G	A	-0.8464
27	Y	A	-0.4526
28	T	A	-0.5326
29	F	A	0.0000
30	T	A	-1.2366
31	D	A	-0.8126
32	Y	A	-0.1051
33	V	A	0.0000
34	I	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	K	A	-0.2850
39	Q	A	-0.8873
40	R	A	-1.6608
41	P	A	-1.3921
42	G	A	-1.3995
43	Q	A	-1.8010
44	G	A	-0.8746
45	L	A	0.1744
46	E	A	-0.1717
47	W	A	0.0206
48	I	A	0.0000
49	G	A	0.0000
50	E	A	0.0000
51	I	A	0.0000
52	F	A	0.0000
53	P	A	0.0000
54	R	A	-1.4088
55	T	A	-0.7765
56	G	A	-0.8356
57	S	A	-0.5896
58	T	A	-0.1810
59	Y	A	-0.6959
60	Y	A	-1.0901
61	N	A	-1.5291
62	E	A	-2.9970
63	N	A	-2.4132
64	F	A	-1.6000
65	K	A	-2.5087
66	A	A	-1.1580
67	T	A	-0.7055
68	A	A	0.0000
69	T	A	-0.5236
70	L	A	0.0000
71	T	A	-0.3879
72	A	A	-1.0628
73	D	A	-1.8004
74	K	A	-2.4895
75	S	A	-1.5075
76	S	A	-1.3821
77	N	A	-1.7695
78	T	A	0.0000
79	A	A	0.0000
80	Y	A	-0.2842
81	M	A	0.0000
82	Q	A	-1.1209
83	L	A	0.0000
84	S	A	-0.5803
85	S	A	-0.5815
86	L	A	-0.8762
87	T	A	-1.2254
88	S	A	-1.9082
89	E	A	-3.1705
90	D	A	-2.8635
91	S	A	-1.4371
92	A	A	-0.8980
93	A	A	-0.5231
94	Y	A	0.0000
95	F	A	0.0384
96	C	A	0.0000
97	A	A	0.0000
98	F	A	0.0000
99	I	A	0.0000
100	T	A	-0.1909
101	S	A	0.0006
102	V	A	0.7743
103	D	A	-0.9505
104	W	A	-0.4124
105	A	A	-0.3728
106	M	A	-0.1122
107	E	A	-1.1895
108	Y	A	-0.2078
109	W	A	-0.0662
110	G	A	-0.7442
111	Q	A	-1.3001
112	G	A	-0.8803
113	T	A	0.0000
114	S	A	-0.5424
115	V	A	0.0000
116	T	A	-0.9057
117	V	A	0.0000
118	S	A	-1.4976
119	S	A	-1.0431
1	R	C	-1.0148
2	L	C	0.9571
3	L	C	0.2933
4	E	C	-0.2301
5	M	C	-0.4725
6	E	C	-1.3103
7	F	C	0.0000
8	E	C	-2.2131
9	E	C	-3.4676
10	R	C	-2.5916
11	K	C	-2.6101
12	R	C	-3.3288
13	A	C	-1.6807
14	A	C	-1.9897
15	E	C	-2.4861