Project name: query_structure

Status: done

Started: 2026-03-16 20:08:24
Settings
Chain sequence(s) A: EAVREVCSEQAETGPCIAFFPRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:10)
Show buried residues

Minimal score value
-3.4212
Maximal score value
3.4018
Average score
-0.6067
Total score value
-36.4016

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.4410
2 A A -1.4964
3 V A -1.1273
4 R A -2.9867
5 E A -3.4212
6 V A 0.0000
7 C A 0.0000
8 S A -1.7058
9 E A -3.1773
10 Q A -2.4184
11 A A -1.8755
12 E A -2.1938
13 T A 0.0341
14 G A -0.3528
15 P A 0.0573
16 C A 1.3190
17 I A 2.9123
18 A A 2.5123
19 F A 3.4018
20 F A 2.3809
21 P A 0.7954
22 R A -0.3417
23 W A -0.8513
24 Y A -1.0972
25 F A 0.0000
26 D A -0.9991
27 V A 0.1430
28 T A -0.5443
29 E A -1.9919
30 G A -1.3227
31 K A -2.1651
32 C A -1.3403
33 A A -0.7751
34 P A -0.5210
35 F A 0.9224
36 F A 2.3794
37 Y A 1.3500
38 G A 0.0000
39 G A 1.1310
40 C A -0.0166
41 G A -1.0911
42 G A -1.8472
43 N A -2.3898
44 R A -2.9012
45 N A 0.0000
46 N A -1.7481
47 F A 0.0000
48 D A -2.2032
49 T A -1.8984
50 E A -2.3542
51 E A -2.0410
52 Y A -0.4901
53 C A 0.0000
54 M A -0.5866
55 A A -0.0410
56 V A 0.2851
57 C A 0.0000
58 G A -0.4012
59 S A -0.2935
60 A A -0.5765
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018