Project name: ref1 [mutate: NA73A]

Status: done

Started: 2026-03-05 15:47:12
Settings
Chain sequence(s) A: MAEDEDNQQGQGEGLKYLGFVQDAATYAVTTFSNVYLFAKDKSGPLQPGVDIIEGPVKNVAVPLYNRFSYIPNGALKFVDSTVVASVTIIDRSLPPIVKDASIQVVSAIRAAPEAARSLASSLPGQTKILAKVFYGEN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues NA73A
Energy difference between WT (input) and mutated protein (by FoldX) 0.637782 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:16)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:11)
Show buried residues

Minimal score value
-4.6661
Maximal score value
2.9333
Average score
-0.0487
Total score value
-6.7181

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4325
2 A A -1.0382
3 E A -3.1637
4 D A -4.0628
5 E A -4.6661
6 D A -4.6327
7 N A -4.1028
8 Q A -3.6555
9 Q A -3.6454
10 G A -2.8707
11 Q A -2.7952
12 G A -2.2218
13 E A -2.5494
14 G A -1.1241
15 L A 0.2953
16 K A -1.0696
17 Y A 0.1018
18 L A 0.8969
19 G A -0.0145
20 F A 0.2559
21 V A 0.4616
22 Q A -1.0545
23 D A -1.4148
24 A A -0.0913
25 A A 0.2973
26 T A 0.3354
27 Y A 0.9549
28 A A 1.2957
29 V A 2.0286
30 T A 1.1537
31 T A 1.1104
32 F A 1.9512
33 S A 1.3446
34 N A 0.4133
35 V A 1.1892
36 Y A 1.0943
37 L A 1.1582
38 F A 0.7877
39 A A -0.3148
40 K A -1.5695
41 D A -2.2595
42 K A -2.2873
43 S A -1.5042
44 G A -1.4375
45 P A -0.4742
46 L A 0.1992
47 Q A -1.1035
48 P A -0.4327
49 G A -0.0245
50 V A -0.1214
51 D A -0.9500
52 I A 1.5643
53 I A 1.6344
54 E A -0.3320
55 G A -0.3661
56 P A 0.0309
57 V A 1.0828
58 K A -0.9916
59 N A -1.0778
60 V A 0.7183
61 A A 0.7751
62 V A 1.3605
63 P A 0.4120
64 L A 0.9223
65 Y A 1.5210
66 N A -0.2620
67 R A -0.1147
68 F A 1.6717
69 S A 0.9388
70 Y A 1.5706
71 I A 1.7032
72 P A 0.8427
73 A A 0.2889 mutated: NA73A
74 G A 0.3879
75 A A 0.7239
76 L A 0.5901
77 K A -0.9431
78 F A 0.9866
79 V A 1.5888
80 D A -0.3419
81 S A 0.5261
82 T A 1.2268
83 V A 2.0073
84 V A 2.8131
85 A A 1.9412
86 S A 1.9848
87 V A 2.9075
88 T A 1.6119
89 I A 2.0725
90 I A 1.0550
91 D A -0.6304
92 R A -1.3805
93 S A -0.5243
94 L A 0.2282
95 P A -0.1437
96 P A -0.0358
97 I A 1.4599
98 V A 0.9242
99 K A 0.0971
100 D A -0.7626
101 A A 0.1368
102 S A 0.8690
103 I A 1.4106
104 Q A -0.4089
105 V A 0.5848
106 V A 0.8086
107 S A 0.0030
108 A A -0.2076
109 I A -0.3582
110 R A -1.7312
111 A A -0.8067
112 A A -1.1113
113 P A -1.3746
114 E A -2.1291
115 A A -0.9477
116 A A -0.7226
117 R A -1.3496
118 S A -0.3119
119 L A 1.1716
120 A A 0.3049
121 S A 0.2697
122 S A 0.6493
123 L A 1.2998
124 P A -0.2020
125 G A -0.5263
126 Q A -0.3725
127 T A -0.6515
128 K A -1.1892
129 I A 1.2033
130 L A 1.2630
131 A A 0.5729
132 K A -0.0370
133 V A 2.2953
134 F A 2.9333
135 Y A 1.3602
136 G A -0.4902
137 E A -2.2088
138 N A -2.0867
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018